I fell in love with @faitherinhicks art style when I read Pumpkinheads, which is one of my favorite graphic novels of all time. When I saw this one was written and illustrated by her, I knew I needed to pick it up. This is such a wholesome, heartfelt story that I thoroughly enjoyed. I really appreciated that they stereotypical roles were reversed in this story. It was such a breath of fresh air. It was a cute, sweet story that I’d definitely recommend picking up. It was a great read and I’ll be purchasing a copy to add to my graphic novel collection, since I borrowed this from the library. 🏷️ #bookstagram #bookcommunity #bookreview #graphicnovel #lgbtbooks #bookrecommendations #bookishpost #recentlyread #bookishaesthetic #bookishvibes #booktok #bookishfeed #bookishlove #cozyvibes #cozyaesthetic #readingdesk #cozydesksetup #cozydesk
Margarita Montimore’s Oona Out of Order is not your typical time travel story. Instead of physically traveling through time, Oona inhabits her body at different points in her life — completely out of order. Naturally, it’s a lot for Oona to take, as she spends her first year acclimating to her new normal, agonizing about the youth that she’s missed out on, hating the body she’s in, annoyed by her mother’s incessant optimism. There are so many elements in this story that open up new perspectives to us, normal people who live our lives chronologically. Montimore excels at reminding us that even while Oona is in a 51-year-old’s body, she’s still just a 20-year-old inside. We mature alongside Oona, as she throws tantrums and as life throws curveballs at her that force her to mature faster than someone living life chronologically. "But there was a freedom in making mistakes, feeling broken, falling into the void, and then climbing out. A freedom in letting go, setting aside, moving on.” — Margarita Montimore, Oona Out of Order For a full review, check out our blog (link in bio) 🌱 Photo ID {A light blue book with half of a woman's illustrated face on the cover, the pieces arranged slightly off-kilter, and a title in bold, white letters that reads "Oona Out of Order" is being held up against a softened background of green plants on shelves. The book is outlined in white with various arrows pointing towards 5-stars, "lessons in letting go" and "Time travel...with a twist".} #Bookstagram #Bookstagrammer #BookishLove #BookObsessed #BookCommunity #BooksBooksBooks #BookClub #BookReview #BookCollection #OonaOutOfOrder #MargaritaMontimore #BookQuotes #TimeTravel
Book Tour Review! 🐺 Thank you to @k.e.turnerauthor & @lovebookstours for including me in this tour! Title: Wolf’s Prize Author: KE Turner Rating: 4/5 My Thoughts: Initially I struggled with this book, I did find it slow starting however once I passed about 30% it picked up for me. When starting this book I hadn’t realised it was a second in the instalment of a series, I think I should of researched this further before starting as elements of the story definitely would of made more sense to me. I believe in book 1 we learn of the traitor and the initial story whereas book two is a continuation of knowing a traitor exists. This story had everything I wanted within it, the plot, action, romance and a deep story to unfold with the characters. The only part of the story which stopped me from giving it a solid five stars would be the writing style, this is just personal preference I don’t take well to third-person writing style so this was definitely something that I didn’t know straight off. Ignoring that everything else about this book I enjoyed and I would be interested in visiting the first book and then doing a reread to see if I can understand the story better. Aimon and Kathryn had great story and plot together; they had some lovely intimate moments which are a credit to the author for writing a lovely pair. If you enjoy paranormal romance set in the medieval times then I’d highly recommend this, also if you enjoy 3rd person storytelling then I’d definitely recommend. I received this copy as an ARC for review but all opinions are completely my own. #Bookstagram #Bookish #ReadingCommunity #BookLover #BookishFeatures #BookAddict #Bookworm #ReadersOfInstagram #BookObsessed #InstaBooks #BookishLover #BookRecommendation #Bookaholic #BookishLife #BookCommunity #BookReview #BookishEscape #CurrentlyReading #FantasyBooks #RomanceReads #YABooks #ForYouPage #Booktok #ForYou #LBTCrew
Avril fût un ÉNORME mois de lecture, surtout en fanfiction. 🩵 🏷️ #books #bookstagramqc #avislecture #chroniquelecture #lecteursduquebec #bookreview #livrestagram #chroniquelitteraire #bookworm #lireplus #booktokquebec #cozyreading #fanfiction #nevmione #nevillelongbottom #hermionegranger #dune #frankherbert #harrypotter #dracomalfoy #drarry
Here After By Amy Lin ⭐️⭐️⭐️⭐️⭐️/5 On a hot August day thirty-two-year Kurtis starts his day by running a half-marathon with Amy’s family. It is the last time Amy will see her husband. Ten days after her husband’s death, Amy finds herself in the hospital making life-or-death decisions. Here After is Amy’s debut memoir that talks honestly about grief and truths about the grieving process. Amy writes, “Everyone is so afraid of grief,” and her strength in this novel shines through and helps you understand that loss is a different beast for everyone. I read this book in a few hours. It is an easy fast paced read that will tear your heart out. There is so much rawness and emotion in this book that you sometimes have to pause and let it sink in. Lin does a great job talking about the grief process because she is experiencing it and shoots down the myths about grief. This is one of my favorite reads of this year so far and will easily be something I will reread in the future. #bookstagram #books #booklover #book #bookworm #bookstagrammer #reading #bookish #bookaddict #booknerd #bibliophile #instabook #booksofinstagram #readersofinstagram #b #read #bookaholic #booksbooksbooks #bookphotography #bookshelf #booklove #love #bookreview #bookcommunity #bookblogger #instabooks #booklovers #reader #igreads #bookrecommendations
📚Book Review📚 ‘Faster than Normal’ by @petershankman 🖤🖤🖤🖤Because mental health fkn matters🖤🖤🖤🖤 #mentalhealthawareness #bookstagram #bookreview #bookblogger #instaread #wednesday #humpday #mentalhealthmatters #momblogger #instablog #bloggersofinstagram #txblogger #satx #satxbloggers #txliving #petershankman #fasterthannormalpodcast #instagood #instalike #mentalhealthadvocate
more charity shop finds 🫶🏼 || have you read either of these? • #bookstagram #books #booklover #reading #bookstagrammer #bookworm #bookish #booksbooksbooks #bookaddict #bookreview #readersofinstagram #booknerd #bibliophile #read #bookcommunity #bookblogger #author #booksofinstagram #booklovers #bookphotography #instabook #reader #bookaholic #b #bookshelf #bookclub #roman #authorsofinstagram #wattpad #thriller
|| 𝙈𝙊𝙎𝙏 𝙍𝙀𝘾𝙀𝙉𝙏 𝙍𝙀𝘼𝘿 📖 25/100 | ⭑⭑⭑ 🗓️ 05/04-05/05 ✅ kindle unlimited Here I am, three days later, not knowing how to feel about this book. It wasn’t bad. But there was just ✨something✨ missing for me. I love when characters are graphic designers in books. That’s what I got my college degree in, that’s what I’ve been doing since I was literally 13 years old, that’s what I love to do and why the things I make on here are sometimes far too extra 😂 The heroine in this book, Grace, is a graphic designer. She was an interesting character, I’ll say that much. I wasn’t obsessed with her, but she also wasn’t the worst character I’ve ever read. Chase. I am confused and perplexed by this man. Some of the choices he made were…choices. He was obsessed with Grace, though, and I love a man obsessed. This book was kind of all over the place for me. Some of the internal dialogue made me cringe. There was a plot point that I don’t understand, and it could have just not been included at all. So this was a miss for me, unfortunately. #knockingboots #bookreview #books #bookstagram #bookish #2024reads #mayreads #reading #booksofinstagram #smalltown #fakedating #forcedproximity #friendstolovers
Check out what’s on my TBR list!! 🛒 The Heaven and Earth Grocery Store—James McBride 🦅 The Invention of Wings— Sue Monk Kidd ❤️ Heart Bones—Colleen Hoover 🦴 City of Bones—Cassandra Clare Like most #bookworms my #TBR list is wayyyyy! Long, but these will give me something to look forward to. It’s a mix of some new and oldies! What is on your TBR list! I’d love 💕 to see what you’re reading! #hellolemon8readers #bookreccomendations #readnation #lemon8books #bookclub8 #lemon8 #blackbox #booktok #bookreview #tbrstack #TBR
Chestnut Springs you have my entire heart!!! - - - - - #bookstagram #booktok #booklover #books #bookreview #bookstagrammer #booknerd #bookshelf #bookworm #reading #nowreading #bookhaul #read #readmorebooks #readersgonnaread #bookaddict #booksbooksbooks #bookish #bookishlove #bookclub #booksta #readingcommunity
📖 𝕓𝕠𝕠𝕜 𝕣𝕖𝕧𝕚𝕖𝕨 📖 Well and Truly Pucked Lauren Blakely ⭐️: 4 🌶️: 5 Pub Date: 05/09/2024 ✨ why choose ✨ one woman & 3 hockey stars ✨ forced proximity ✨ teach me Make it a hockey romance but turn it up a notch, or three!! This was a fun and spicy Why Choose hockey romance. Briar was a strong and independent FMC that rolled with the punches and showed her good for nothing ex-boyfriend that KARMA IS THREE BOYFRIENDS! Well and Truly Lucked is available tomorrow! ✦ Amazon ➜ http://blkly.pub/WATPKindle ✦ Audible ➜ https://blkly.pub/WATPAudible 🌶️🌶️🌶️🌶️🌶️ = what plot? mostly smut 📚Thank you @laurenblakelybooks for the ARC of Well and Truly Pucked! ••••• #wellandtrulypucked #laurenblakely #myhockeyromance #romancebooks #whychoose #hockeyromance #friendstolovers #rivalstolovers #sportsromance #romcom #spicyromance #bookreview #goodreads #mustread #whativeread #read #bookstagram #igreads #newreleasebooks #currentlyreading #booklover #arc #arcreader
Thank you @simonbooks for my free copy of The House Is on Fire by @rachelbeanland — available now in paperback! Read this if you: ✨ are a historical fiction lover 🎭 appreciate complex, empathic characters 💓 want an emotional read that will affect you! In 1811, a Richmond play house goes up in flames during a performance, trapping hundreds inside. In the struggle to get out, many are trampled while others make the decision to risk jumping from a second- or third-story window. Sally tries desperately to make her way from the third floor with her sister-in-law, helping anyone she can along the way. Cecily, in the gallery with the other slaves, makes her way out easily but contemplates pretending she didn’t. Jack, a stagehand, is plagued by guilt over his part in the accident. And Gilbert, enslaved to a cruel master, is lauded as a hero for catching some dozen women dropped from a window. The incident changes them all irrevocably, but will it be for better or worse? This. Book! Wow did it surprise me. The fast pace and compelling characters drew me in instantly, and I much enjoyed the story. The events are based in truth, and the author’s note dives into the history and the characters (real and imagined) which I always appreciate in historical fiction! Gilbert’s story is pretty gutting and affected me the most, but all four characters stirred up a lot of empathy and held my interest. I really enjoyed this one and highly recommend giving it a read! ⭐️⭐️⭐️⭐️💫 QOTD: have you ever watched a live play? I’ve seen several, I love plays, ballet, and opera! Such a fun date night for us. #thehouseisonfire #simonbooksbuddy #simonbooks #bookclubreads #playhouse #histfic #historicalfiction #americanliterature #americanhistory #emotionalbooks #newbooks #bookreview #bookrecs #homelibrary #librarygoals
🩷🎀🌷💕On Wednesday’s we read pink 💕🌷🎀🩷 I am obsessed with how cute these pink books all look together! We made it half way through the work week!!!🙏🏻 Maybe celebrate by getting a new book 🤷🏼♀️ QOTD: What color is the cover of your current read? . . . #bookclub #fantasybooks #bookobsessed #bookaddict #booklover #books #romantasy #romantasybooks #bookworm #fantasy #bookstagram #bookstagrammer #bookish #bookreview #reading #readersoninstagram #read #taylorswift #pinkstack
𝗙𝗜𝗡𝗔𝗟 𝗦𝗖𝗢𝗥𝗘 𝗠𝗔𝗬 𝗦𝗣𝗢𝗧𝗟𝗜𝗚𝗛𝗧✨ this month’s author spotlight is Julia Connor’s and the 𝑭𝒓𝒐𝒛𝒆𝒏 𝑯𝒆𝒂𝒓𝒕𝒔 series! 🩵 𝐓𝐡𝐞 𝐁𝐨𝐱 𝐒𝐞𝐫𝐢𝐞𝐬 𝐈𝐧𝐜𝐥𝐮𝐝𝐞: ✨On the Edge ✨Out of Bounds ✨One Last Shot ✨On the Line ✌🏻𝐓𝐰𝐨 𝐎𝐩𝐭𝐢𝐨𝐧𝐬: 🩵Paperback $120.00 USD + shipping 🩵Hardcover $160.00 USD + shipping (LIMITED) 𝐁𝐨𝐱 𝐃𝐞𝐭𝐚𝐢𝐥𝐬: ✨All books will feature a 𝐝𝐢𝐠𝐢𝐭𝐚𝐥 𝐬𝐢𝐠𝐧𝐚𝐭𝐮𝐫𝐞 ✨Cover will have a 𝒍𝒖𝒙𝒆 𝒇𝒊𝒏𝒊𝒔𝒉 + 𝒄𝒖𝒔𝒕𝒐𝒎 𝒊𝒏𝒕𝒆𝒓𝒊𝒐𝒓 𝒇𝒐𝒓𝒎𝒂𝒕 🫶🏻Preorder will run 𝐌𝐚𝐲 𝟖𝐭𝐡 (𝟕𝐚𝐦 𝐏𝐒𝐓) - 𝟐𝟐𝐧𝐝 (𝟏𝟏:𝟓𝟗𝐩𝐦 𝐏𝐒𝐓) 🌟All Sales Final 🌟No Cancellations 🌟No Returns 🌟No Refunds 🌟Final Score is not responsible for the package once checked into the post. 🌟Final Score is not responsible for any Duties/Taxes on International Orders. 🤩These covers were done by Silver @bittersagedesigns 🤩Interiors were done by Cleo @devotedpages_designs 𝚌𝚘𝚍𝚎: 𝙲𝙷𝚁𝙸𝚂𝚃𝙸𝙽𝙰𝟷𝟶
Crash by Iosbel Ross A 5 star 🌟 read 📚 👓😍from me. Blurb: A novel of searing suspense that How many lies can one family endure before it all comes tumbling down?Alice’s marriage to a wealthy, controlling businessman, Carl, has been troubled for years, and her adult daughters keep their distance. But now, with Carl’s long-term drug addiction spiraling into a crisis, her teenage son is falling in with a bad crowd. And Carl’s business partner is making threats as their company descends into financial disarray.In the midst of all this, Alice has allowed herself one source of a relationship with another man. But will it be a lifeline, or lead to the final collapse of this house of cards? 🌟📚👓😍 #read #book #reading #books #bookstgram #bookworm #booknerd #bookblogger #ilovereading #ilovebooks #5starread #bookreview #crash #family #arccopy #bloodhoundbooks #isobelross @bloodhound.books
📖 #sunnreads Membaca buku serasa berkaca? Judul: Tentang Luka Yang Aku Simpan Sendiri Penulis: @kopioppi Penerbit: Syahlamat Publishing Tebal: 142 hlm Iya, membaca buku ini aku serasa berkaca, melihat refleksi diri sendiri yang penuh dengan luka. 🌷Kak @kopioppi dengan tulisannya mengingatkan kita bahwa tidak apa-apa untuk merasa sedih, namun kita juga perlu mengingat bahwa kita tak sendiri. Banyak dari kita memiliki luka yang sama dan jika salah satu diantara kita saja bisa bangkit kenapa tidak dengan kita? 🌷Sebuah buku yang memberi pelukan dalam bentuk kata-kata yang membuat aku gugup sesaat karena merasa terpergok. Dalam hati aku berkata; padahal aku sudah berusaha sebaik mungkin menyimpan lukaku agar tak banyak orang yang tahu, tapi buku ini dengan begitu transparan membuka beberapa luka yang berusaha aku sembunyikan. 🌷Buku ini seperti menjadi jembatan emosi bagiku, yang menghubungkan aku dengan banyak orang yang pernah merasa sama, di mana setiap halaman membawa pengertian bahwa kita tidak pernah sendiri, banyak orang-orang disekitar kita yang peduli, kita sering merasa sendiri karena kita merasa sakit kemudian menutup diri. Padahal diluar sana banyak dari teman dan saudara kita yang mencoba untuk memeluk. ✨Terima kasih kepada @tokobukuyanita sudah memberi aku kesempatan memeluk buku ini 🫶 @gerakan_1week1book #owob #bookreview #bookphotography #bookmail #bookaesthetic #booksrecommendation #bookstagram #selfimprovement #selflove #selfhealing #reviewbuku
4th Degree 𝙰𝚞𝚝𝚑𝚘𝚛: Nikki Castle 𝚁𝚎𝚕𝚎𝚊𝚜𝚎 𝚍𝚊𝚝𝚎: May 3rd, 2024 ℝ𝕒𝕥𝕚𝕟𝕘: 🌟🌟🌟🌟 𝕊𝕡𝕚𝕔𝕖: 🌶🌶🌶🌶 Ｂａｎｔｅｒ：5/10 𝚃𝚛𝚘𝚙𝚎: Age Gap, Coach/Athlete, MMA, Forbidden Romance, Sports Romance, Found Family 𝓢𝓮𝓻𝓲𝓮𝓼 𝓸𝓻 𝓢𝓽𝓪𝓷𝓭𝓪𝓵𝓸𝓷𝓮?: Book 5 of The Fight Game **ARC reader thanks to @theauthor.agency ** ᴍʏ ʜᴏɴᴇsᴛ ʀᴇᴠɪᴇᴡ: I am so SORRY this is so late! I had a sick toddler and I’ve been sick. (FYI My reviews never contain spoilers) Dominic is a well-respected MMA coach who meets a new student Skylar. Skylar is GOING THROUGH IT. Poor thing has to take care of her entire family all while balancing multiple jobs, school, and trying to find an outlet to get personal time and get air. Dominic FIGHTS himself hard for his feelings for Skylar until Skylar goes for what she wants. The vulnerability is AMAZING and such heartfelt communication that only Nikki provides. Just WOW! #bookstagram #bookcommunity #bookreview #booklover #dirtyreads #ciaoamandareads #instabooks #raunchyreads #smut #bookaddict #raunchyromance #explorepage #bookstagrammer #booksta #reading #readingisfun #bookworm #booknerd #kindleunlimited #kindle #kindlelover #KU
📚 #BookReview - #Redemption by @jackjordan_author Jordan returns with a thriller so powerful you’ll never stop thinking about it! It’s no secret that I’m a huge fan of Jordan’s books and as such, I have the highest expectations for each new one. DO NO HARM is one of my all time favourite books, but REDEMPTION has come along and absolutely blown me away. There’s elements of the popcorn, action thriller that I loved DO NO HARM for, but these punctuate a much deeper, more painful story that is utterly breathtaking. REDEMPTION is the evolution of Jack Jordan, firmly putting him on the map as one of the greatest crime writers of our generation. This book has it all: action, suspense, brutality, but also heart, love, beauty. It blends so many emotions together into a cauldron of pain, anguish, violence and ultimately hope. The pace starts off very evenly, building a detailed picture of Evelyn and Tobias, their relationship, the loss of their son, and the fissures this has caused in their marriage. The narrative is so much about grief and Jordan paints a very deep and heartfelt portrait of it. I felt every ounce of this couple’s pain, it got under my skin and rooted in my very soul. We then meet Aaron - the young man responsible for the death of Evelyn and Tobias’s son, Joshua - and I expected to feel some of Evelyn’s anger. However, Jordan has created characters who are the very epitome of humanity. They are flawed, but they are essentially good. They are the product of their experiences and I immediately felt compassion for all of them. I felt incredibly invested in all of these characters, which really had me turning the pages. The moments of blistering action were explosive and Jordan knows how to perfectly blend these with the more emotional aspects of the plot, keeping things moving forward with tension and suspense. This book will equally appeal to those who enjoy a taut and exhilarating thriller and those who relish a more literary and emotional thriller that gets you thinking. (Contd in comments)
⟡The Last Housewife by Ashley Winstead⟡ ★★★ 3/5 stars “𝘛𝘩𝘦𝘳𝘦’𝘴 𝘯𝘰 𝘴𝘶𝘤𝘩 𝘵𝘩𝘪𝘯𝘨 𝘢𝘴 𝘢𝘯 𝘰𝘣𝘫𝘦𝘤𝘵𝘪𝘷𝘦 𝘰𝘣𝘴𝘦𝘳𝘷𝘦𝘳. 𝘛𝘩𝘢𝘵’𝘴 𝘸𝘩𝘺 𝘴𝘵𝘰𝘳𝘪𝘦𝘴 𝘢𝘳𝘦 𝘱𝘰𝘸𝘦𝘳𝘧𝘶𝘭. 𝘐𝘧 𝘺𝘰𝘶’𝘳𝘦 𝘭𝘪𝘴𝘵𝘦𝘯𝘪𝘯𝘨, 𝘺𝘰𝘶’𝘳𝘦 𝘱𝘢𝘳𝘵 𝘰𝘧 𝘪𝘵.” ⟡ read if you like : • The Handmaids Tale • cultish/NXIVM vibes • podcast transcripts - dark reads - You’re in a cult, call your dad. ( #ssdgm) ⟡ synopsis : After hearing about case that hits close to home on her favorite true crime podcast, Shay is on a mission to dismantle the violent, patriarchal cult that she escaped years ago & avenge her best friend’s death. ⟡ my thoughts : It’s no secret that I’m a huge fan of going into books blind, I usually just see good reviews & add to my TBR! But this is one of those rare cases that it didn’t work in my favor. There were things about this one that I really liked, & things I didn’t. There were some wild twists (albeit at times outlandish), & I loved the true crime podcast aspect of it. It truly was unique to say the least. I will say that despite the cultish topic not being my cup of tea, the writing style & podcast interview format was well done & kept me engaged with the story. I think the biggest downside for me was despite the foreboding feeling that there was “no way out” of this cult once you’re in, our MC Shay was always able to get out of each sketchy situation just in the nick of time. 🤔 I liked The Last Housewife better than In My Dreams I Hold a Knife, & I did enjoy reading it, but it still wasn’t my favorite. l’ve seen tons of amazing reviews for this one, so take my thoughts lightly! If you’re willing to suspend belief a bit & you enjoy super dark thrillers, then this one could really work for you! *I highly recommend checking trigger warnings before reading → What was the last book that booksta loved but you didn’t? → is there a dark thriller book you’d recommend?
A Court of Mist and Fury by @sarahjmaas Ferye: "To the people who look at the stars and wish, Rhys." Rhysand: “To the stars who listen— and the dreams that are answered." This book is worth my sleepless hour. Do you ever find a book you really enjoyed and find hard to review because what it leaves you with is a wordless feeling rather than a few thoughts? That's what ACOMAF was... #acomaf #acourtofmistandfury #sarahjmaas #author #fantasy #thriller #romance #rhysand #rhys #ferye #rhysandfeyre #acotar #books #bookbookbook #bookinstagram #bookreview #acourtofthornandroses #tamlin #cassian #azriel #lucien #booktok
It’s Wednesday, and I have a weirdly specific book for you! Looking for a book with a magical attic, a woman trying to decide what she wants in life, and a mix of Groundhog Day and Eternal Sunshine of the Spotless Mind? The Husbands by Holly Gramazio has all of the above (and more, swipe to see)! I personally gave this book a ⭐️⭐️⭐️⭐️ rating. The plot was so unique, and I loved the set-up as we began following Lauren and her many husbands. Lauren’s life changes to some degree with every new option, and it was fascinating to see all the different things that could change. She had different weddings, different furniture and paint colors in her apartment, different relationships with her neighbors, even different pets! Without any spoilers, there are a few twists introduced around the halfway point which fully grabbed my attention. Unfortunately, after the secondary twists, there were enough husbands passing through to give me a sense of fatigue. Even though the majority of them never even get a name, I started to feel like I was wading through men in my mind, trying to keep it all organized. The ending really saved the book for me, pulling me back to being fully focused on Lauren. I loved that we finally got a second point of view, and that it wasn’t a perfect, clear-cut ending. If any of this book’s weirdly specific traits caught your eye, you should definitely give it a shot! I’d also recommend it if you’re looking for a magical realism take on dating as an adult! . . . #thehusbands #thehusbandsbook #thehusbandshollygramazio #weirdlyspecific #weirdlyspecificwednesday #weirdlyspecificwednesdays #weirdlyspecificwednesdaybook #weirdlyspecificwednesdayreview #bookstagram #booktok #bookreview #bookreviews #bookrecommendation #bookrecommendations #readingtime #booklover #bookreader #readmorebooks #books #bookstagrammer #bookworm #bookish #booksofinstagram #booksbooksbooks #bookphotography #bookcommunity #readersofinstagram #bookreviewer #readingcommunity #readinglife
the best time of book-shopping days are the ones with friends #romantasy #bookshopping #yafantasy #magic #bookseries #bookaddict #elves #reading #bookstore #powerless #booklovers #bookish #bookreview #greatreads
In 'Perfect Unity', @cunninrm takes us on a journey through the central doctrines of the faith, helping us celebrate diversity while maintaining unity. Read our review - link in bio.
✨Book Review✨ Kingdom of Flames and Flowers By Raven Storm I am a big fan of romantasy and that is absolutely what this is! This book is a dragon shifter, why choose romance! Honestly it checked all my boxes for a great fantasy romance, FMC with a tragic back story, corrupt royalty, touch her and die MMC(s), nothing is as it seems plot, geeat world building, great spice(definitely not a slow burn)…. But it just seemed to lack something for me. It was a pretty linear plot line with not much going on in the background..and I love a good side story! Aside from one little plot twist, the charaters were all fairly strait forward. I gave this book ⭐️⭐️⭐️ and 🌶️🌶️🌶️! Was it a good book, yeah! Will I be reading the next in the series.. probably not. #bookreview #bookrecommendations #romantasy #booktok #booktokdirtytome #bookstagram
Kitapyiyenler // Sunyi Dean #kitapyorumu 🤓 “Sen bana yardım etmek için bütün dünyayı yersin ve sanırım ben de senin için aynısını yapardım. Sen benim canavarımsın ve ben senin canavarınım.” Kitapyiyenler son zamanlarda okuduğum en farklı romandı. Kitapları ve zihinleri yiyerek var olan, geleneklerine bağlı ve izole bir yaşam süren bir tür üzerinden annelik, koşulsuz sevgi, zor kararlar, etik ve kadının toplumdaki konumu dahil birçok konu içeriyordu. Hem akıcıydı hem de bazen içimi darladı. Aynı anda feminist bir distopya ve de Nail Gaiman fantastiği okuyor gibiydim. Kitabın başlarında hikayeye girmem biraz zaman aldı ama sonrasında kitabı elimden bırakamadım. Devon’un yaşadıkları, yaptığı seçimler ve bunların sonuçları okurken insanı etkisi altına alıyor. Anne olmak ve sevgi Devon’un yaptıklarını haklı çıkarır mı? Devon ve Cai’nin çarpık ilişkisi bazı kısımlarda rahatsız ediciydi. Yine de öyle bir geleneğin içinde anneliğe ve evlatlarına tutunmuştu. Kitap boyunca Devon için, onun adına kararlar verilmesine ve geride bıraktıklarına üzüldüm. Kitapyiyenlerin dünyasını ve kurallarını anlayana kadar da geçmiş ve gelecek arasında gidip gelmeye başlamıştık. Bu sayede kitabın ilk 100 sayfasından sonrası çok daha ilgi çekiciydi. Kitabın gotik havası hikayeyle de birleşince ağırlık katmıştı. Akıcılığa rağmen o ağırlığı hissedebiliyorsunuz. Kitapyiyenler herkese hitap eder mi emin değilim. Yine de farklı türlerde kitaplar okumayı seviyorsanız bu kitaba bir şans verin 🍀
CHECK IT OUT!!!! #ImHerMother is now on #Netgalley! Go go go! We both say she’s our daughter. But one of us is lying… My little girl Lola is my whole world. Three years old and so beautiful – all golden curls and dimpled cheeks. But on our way home from holiday she was stolen, whisked away in the blink of an eye. I can’t breathe without Lola. I don’t know how to get her back. The woman who has my daughter is on the run. And she has no intention of bringing Lola home. Because she says she’s her mother. But that’s impossible, because I’m Lola’s mother. Though really, I should have known my secrets would come back to haunt me. That this day was always going to come… Two women claim that Lola belongs to them. Two women with something to hide. Only one is telling the whole truth… Who will you believe? An absolutely addictive psychological thriller, where no one is who they seem, and you don’t know who to trust until the very last page! Perfect for fans of gripping page-turners like The Housemaid, The Family Across the Street and None of This Is True. #bookblogger #bookstagram #booklover #bookstagrammer #books #bookworm #bookish #bookaddict #booknerd #book #bibliophile #booksofinstagram #bookphotography #reading #bookaholic #bookblog #readersofinstagram #bookcommunity #bookreview #booksbooksbooks #booklove #b #instabook #bookshelf #igreads #read #instabooks #reader
4⭐️ I’ve never read a book by this author so I went in with very low expectations and they were blown right outta the water. Loved the two main characters but the real MVPs of the book were the girls on the soccer team. Hilarious. #booklover # #booksbooksbooks #bookstagram #thelonggame #thelonggamebook #adalynandcameron #greenoaks #romancebooks #slowburnromance #romcombooks #bookrecommendations #bookreview
Ammm...... #reading #bookstagram #books #book #booklover #read #bookworm #bookish #bookstagrammer #booknerd #bookaddict #bibliophile #readersofinstagram #instabook #love #booksofinstagram #reader #bookaholic #readingtime #bookshelf #writing #booklove #literature #bookphotography #booksbooksbooks #b #author #instabooks #bookblogger #bookreview
This was the first audio book I've listened to in a long time, which i think colored some of my experience. Overall, I liked the story and the themes of friendship. The shenanigans that happen with the beauty pageant are very accurate to the young adult style. I liked Chicky's voice and sisters a lot. I was confused, however, by Lita being made of stardust. There was nothing in the description about it, so when it was first mentioned, I thought it was a metaphor. I honestly thought it was for a majority of the story. I wasn't against it, but it would've been nice to know about that fantasy element going into the story. For the audio book aspect, I think the voice actors did a great job. I was listening to the cd version, and I didn't love that the cds sometimes split chapters in the middle to switch cds. #missmeteor @tehlorkay #annamariemclemore #youngadult #fiction #books #bookreview #booksofinstagram #bookstagram #audiobook
Shea inherited a lot of "Rules for Life" from her beloved Nonna. There were rules for everything, but the one that really stuck with her was "Never get engaged with an heirloom ring." So, of course, her boyfriend proposes with an heirloom ring (I mean, did she not tell him?). She is convinced that any ring will carry all of the bad karma from the marriages that have been associated with it in the past. Basically, what follows is a very large over reaction to an heirloom ring. I wondered for a while if maybe she just really didn't want to marry the guy, but this would even be an over reaction to that. It's a pleasant enough story with Shea travelling to Italy and Portugal to trace the history of her ring. You just have to be willing to go along for the ride without really worrying about the practicality of spending thousands of dollars because of a superstition. #bookstagrammer #reading #books #netgalley #thebrowndogreads #thebrowndogbookshop #italy #Bookreview #Fiction #newrelease
Have you gotten your hands on North Woods by Daniel Mason yet? It’s a great read and so refreshing to have a new story unlike so much else out there right now. Loved it! See my review in The Link in bio. #linkinbio #readingwednesday #northwoods #danielmason #bookreview #bookrecommendations #readersofinstagram #readwithme #myfabfiftieslife
REVIEW AND RECOMMENDATION: Through All Time by Jen Shaffer This was surprisingly good. It was a romantasy spin I hadn't encountered before. I loved all the different characters. The love story between the main characters was really well done. There was spice and still sweetness and even suspense. Blurb: What’s one lifetime, when he’s been fighting to save her since the beginning of time? They imprisoned his soul. She was the promise he needed to be set free. He loved her through the time that separated them. Every new incarnation of her life brings her back to him, until her life is taken again in hopes of trapping him in an eternity of suffering. If it takes his very last breath, Gabriel will fight to keep her safe, keep her free, keep her alive. She is everything to him. His life. His love. His soulmate. They didn’t want him to have her. He would do whatever it took to keep her. THROUGH ALL TIME is perfect for fans of Amiee Robinson’s Angels Duty, Olivia Wildenstein’s Feather, and JR Ward’s A Novel of the Fallen Angels. If you're looking for a story filled with love, laughter, and tears, this is the book for you. @jenshaffer.author #booklover #bookstagram #romancebooks #romancereader #fantasybooks #fantasyromance #spicyromance #bookrecommendations #bookreview #timetravelromance #bookgirl #romancereads
📣 LAST CALL. If you're a NetGalley reviewer, put in a request for The Summer of Love and Death! The digital ARC is only available until May 11th. What NetGalley reviewers are saying... "Riveting from the first page!" "Beautifully-crafted mystery." "McCreary is a master of mystery." "An intriguing case and plenty of twists!" "Loved the dual timeline." "McCreary keeps the reader in the middle of the action." You can pre-order wherever you buy books! On sale: August 13th #crimefiction #suspensenovels #mysteryreaders #suspensebooks #mysterybook #authorlife #mysterybooks #authorslife #mysterynovels #mysterywriters #detectivenovel #mysteryfiction #bookstagram #summerreading #bookrecommendations #newbookreleases #summerreads #thesummerofloveanddeath #NetGalley #bookreview #bookreviews #crimefictionlover
Things We Never Got Over by Lucy Score ⭐️⭐️⭐️/5 🌶️🌶️🌶️/5 This book had been on my TBR for almost a year, and I found myself not opening it a lot. Decided to jump headfirst into Knockemout, and I am so happy that I did. To me, the story started a little slow and I had a hard time getting into it but once I got to know Knox and Naomi I was eager to read more. It started a little cliche with the evil twin sister, but I found that there was more than surface level cliches with it. Waylay was one of the best parts of this story, and lives up to the definition of her name. Waylay means to stop or interrupt someone and she completely interrupted Naomi’s plans (although it wasn’t totally Way’s fault). Waylay was the best thing to happen to Naomi and Knox, who loved nothing more than to accept her with open arms. The chemistry between Knox and Naomi was quite enjoyable to read and definitely added something to the story. One of my favorite things is the symbolism of Daisies on the cover cause it means so much in the story. After finishing the book, I read the bonus chapter that is on Lucy’s website site and it was the perfect ending 🥹🥹 (However, it did have a few spoilers for the rest of the series). While this wasn’t my favorite book ever, I 100% think you should pick it up. #thingswenevergotover #lucyscore #bookstagram #booklover #bookreview #bookaddict #bookworm #bookrecommendations
⭐️⭐️⭐️⭐️⭐️ Persona normal -Benito Taibo Una aventura increíble a través de los ojos de Sebastián , un chico de 12 años que nos lleva a reflexionar sobre varios aspectos de la vida. Con una biblioteca magnífica que muchos quisiéramos tener en casa y una figura como el tío Paco, quien acompaña a Sebastián mientras se convierte en adulto. Una aventura para ser todo … excepto normal #bookstagram #bookreview #benitotaibo #personanormal #bookworm
my five star reads of 2024 so far 🧡 books included: 🔸 you with a view / @jessicajoycewrites 🔸 swift and saddled / @authorlylasage 🔸 just for the summer / abby jimenez 🔸 queen of shadows / @sarahjmaas 🔸 saving 6 / @authorchloewalsh 🔸 redeeming 6 / chloe walsh 🔸 only for the week / @natashabishopwrites (I already packed my physical copy 😭) this does not include any rereads bc we already know those are mostly five stars 🤡 what’s been one of your favs this year so far? 🧡 #fivestarreads #booksbooksbooks #romancebooklovers #bookrecs #bookrecommendations #bookstagram #readmorebooks #booktok #bookshelf #allthebooks #bookstagram #books #booklover #book #bookworm #bookstagrammer #reading #bookish #booksbooksbooks #bookshelf #booklove #bookreview #bookcommunity #bookblogger #booklovers #bookrecommendations #readingwrapup #audiobookstagram #romancebookstagram
The Cry Of The Night by @alexvalewrites I received this as an ARC, which I am incredibly thankful for. It releases May 21st, so just a few more weeks. The twists, the depth and the action were impeccable. Alex's writing is amazing, the storytelling as well. I can't imagine you not wanting to continue reading this series after the brutal cliffhanger the first book left us with. I will rate this 5 stars, and can't wait for the next! #mm #mmromance #vampires #enemiestolovers #paranomal #emotional #5stars #review #arc #bookreview #book #bookstagram #bookstagrammer #alexvale
A Court of Mist and Fury by @sarahjmaas Ferye: "To the people who look at the stars and wish, Rhys." Rhysand: “To the stars who listen— and the dreams that are answered." This book is worth my sleepless hour. Do you ever find a book you really enjoyed and find hard to review because what it leaves you with is a wordless feeling rather than a few thoughts? That's what ACOMAF was... #acomaf #acourtofmistandfury #sarahjmaas #author #fantasy #thriller #romance #rhysand #rhys #ferye #rhysandfeyre #acotar #books #bookbookbook #bookinstagram #bookreview #acourtofthornandroses #tamlin #cassian #azriel #lucien #booktok
If Something Happens to Me by Alex Finlay - Review 📖 Genre: Thriller My rating: ⭐️⭐️⭐️⭐️ (4/5) Pub date: May 28th! TW: yes, DM me! Thank you, @minotaur_books, for my ARC! 💙 Read if You Like: 🏃🏼♀️➡️ Short, fast-paced chapters 😨 Cliffhangers at the end of chapters 🗣️ Multiple POV ⏰ Discrete dual timelines 📍 Following several settings/locations 🕸️ A web of lies & twists that seems impossible to connect… until it does 👨🏻 Mobster + hit-men thrillers ✨ I would go in blindly, after you check trigger warnings!! Makes the plot so much more fun. Message me or check GR if you need a synop before starting, though. ☁️ Thoughts: This was wild! It sucked me right in from the very first page/the prologue. Another thriller where I had to take thorough character notes because SO much was going on; honestly, that’s mainly why I’m giving it 4⭐️ rather than 5, because it felt like tooooo much was happening at times & my brain was working a little too hard to keep up. 🤣 I love thrillers that are divided into multiple parts, like this one; the twist at the end of part 1 was pretty epic! Certainly did not see it coming. 🙌🏼 The chapters were all very short in length & the pacing was consistent throughout- this definitely isn’t one you will be bored with! The perfect thriller for a quick weekend binge. I do think the ending was a bit abrupt/needed a bit more after all the juicy chaos that was happening throughout, but overall, this was a good one! I really enjoyed Finlay’s previous novel The Night Shift (4.5⭐️), & this was a close second. Every Last Fear & What Have We Done remain on my TBR, but I definitely plan to read all of his works! I recommend!
#qotd : What are you currently reading/TBR? প্রণয়নামা তানভীর অনয় লেখকের প্রায় সব গুলো বই ই আমার পড়া। উনি সবসময়ই চেষ্টা করেন নতুন কিছু নিয়ে লেখার। ওনার বাকি চারটা বই থেকে এই বইটা বেশ আলাদা,বেশ ছিমছাম। এক বসাতেই পড়ে ফেলা যায় এমন। প্রণয়নামা বইয়ের নাম দেখে যে গদগদ প্রেমের কাহিনী হবে জিনিস না এমন না দেখে ভালো লাগলো। দুজন মানুষকে নিয়ে বইটা লেখা যারা হয়তো কেউই জানে না আসলেই প্রণয় বলতে কি বোঝায়। শেষে লেখক বেশ সাসপেন্স দিয়েই বইটা শেষ করলো,আরেকটু জানালে খারাপ লাগতো না। । । । । । । । । । । । । । । । । । । । । । । । । । । । । । #bengaliquotes #bookishfeatures #bookstagrammers #bangladesh#বই #igreads #booksofinstagram #banglabooks #bookcommunity #bibliophile #booksoninstagram #bookstagrambd #bookstagramcommunity #bookchallenge #readingaddict #bookishgirl #bookstagramer #books #booksbooksbooks #bookshelves #books📚 #bookaddict #bookshelf #bookreview #bookstagramfeature #bookaddicted #bookobsessed #bookstagtam #bookstagrams
Book Review: The Book That Broke The World by Mark Lawrence *Spoiler free* Just like with book 1, I have strong mixed feelings about this book. It's well written, has some great quotable moments, appealing characters, although they did feel a little weaker in this installment, and has good actions scenes but I'm so fing confused about what is going on that I can't love it. Seriously, my brain hurts, and I feel dumber for trying to understand. It's all Dr. Who and time is wibbly wobbly timey wimey stuff. I did start to feel like I could better understand things coming together towards the end of the book, also reminiscent of book 1, but my goodness, my brain hurt for the majority of this book. I don't want to spoil anything, but I will say that it massively detracts from my enjoyment of the book. I'm unable to just read. I keep trying to pause to sort everything out in my head, which hasn't worked so far... We have a few more POV chapters in this book, which honestly ended up detracting from my overall enjoyment of the characters, I think. It weakened how much time we spent with any one POV, and this book was a lot shorter than book 1. I felt like I didn't get enough time with Evar and Livira, the main characters of book 1. I didn't hate the additional POVs, and I get why one of them is essentially necessary but there were times when all the POVs were together so when they switched we got some telling of what had just happened again. It felt really off-putting for the book to be like, "and now from this POV, these same things happen." I feel like there's a really strong story here, and I think I'm going to stick it out and read book 3. I'm already invested, and I have time to let my brain heal and stop hurting. I just really really hope book 3 brings everything together to make sense and blows my mind with a "oh holy fing s that's amazing" sort of finale. Note: No the cover is not supposed to look like this. This is my TBB special edition and the gold foil of the title rubbed off while reading. 🫠 Yea not a fan but I didn't notice until the damage was done. I guess there is something to be said for r eading with the dust jacket off. Which way do you read?
book review☕ I read Holly Jackson's a good girls guide to murder series, and the reappearance of Rachel prince and I finally got to read five survive... omg what a crazy time. I genuinely enjoyed the plot twists in this. I had so many guesses of what was going to happen, but I was proved wrong. I loved this book so much! 8/10 #bookreader #bookclubofinstagram #bookaccount #bookstagrammer #reading #hollyjackson #fivesurvive #bookreview #booktok #book #kobo #kobolibracolour
Book:- Kashmir: Book 3 of The Partition Trilogy Author:- Manreet Sodhi Someshwar Genre:- Trilogy Language:- English Format:- Paperback Page:- 303 Rating:- ⭐⭐⭐⭐⭐ The book came to me with a special packet. The cover page illustration is beautiful and contextual. I just finished reading "Kashmir: Book 3 of The Partition Trilogy" by Manreet Sodhi Someshwar. This is a gripping tale of the tumultuous events surrounding the partition of India in 1947. The author weaves together the stories of various characters, from Maharaja Hari Singh to ordinary citizens like Durga Mehra and Kashmira, to provide a comprehensive view of the chaos and violence that engulfed Kashmir during this period. The book vividly portrays the political maneuvering, personal tragedies, and acts of bravery that defined this pivotal moment in history. The author's attention to detail and rich character development make for a compelling read that will keep readers on the edge of their seats. Overall, "Kashmir" is a powerful conclusion to The Partition Trilogy, offering a unique perspective on one of the most significant events in modern Indian history. It is a must-read for anyone interested in historical fiction or the complexities of South Asian politics. Give this excellent book a try. 📚 Plz Like❤️ , Comment💬 , Share🚀 Follow this account @travel_books_only for more book reviews and recommendations. #kashmir #trilogy #book3 #partitiontrilogy #books #booklover #bookish #bookstagrammer #bookworm #reading #bookaddict #readersofinstagram #bookreview #author #booknerd #bibliophile #read #bookrecommendations #bookblogger #bookphotography #instabook #booksbooksbooks #reader #bookaholic #booklovers #bookshelf #booksofinstagram #literature #library
ARC REVIEW: Thank you to @macmillan.audio for the ALC & @smpromance for the ARC. All opinions are my own. TITLE: One Last Shot AUTHOR: Betty Cayouette NARRATORS: Brittany Pressley & Sean Patrick Hopkins PUB. DATE: May 7, 2024 RATING: 4⭐️ SPICE LEVEL: 2.5❤️🔥 Read if you like: - stories set in Italy - second chance romances - dual POVs - modeling - photography - dual timelines 🎧 The audio was excellent for this story. The narrators fit the characters so well, and I appreciated having the two narrators for the dual POVs. I found the timeline in the past to be so sweet. I loved seeing how Emerson and Theo came to be friends. The modeling and photography behind the scenes was really interesting, and I liked the setting. Overall, I would recommend this book. My only negative about the book was the lack of communication at times. #BookReview #BookReviewer #MacAudio2024 #Audiobook #AudiobookReview #NewRelease #RomanceBook #SecondChanceRomance #OpenDoorRomance #OneLastShot #BettyCayouette Is this on your TBR?
[BOOK REVIEW: ELIXIR DE KAPKA KASSABOVA 🌿] Hello les readers ✨ ALERTE COUP DE COEUR ❤️ @kapka_kassabova a encore frappé ! Comme je l'ai deja dis en story ou dans mon dernier bilan de mois, grâce à ce livre j'ai pu déterminé avec certitude que cette autrice bulgare est mon autrice contemporaine préférée 💕 Ces récits sur la nature, les générations, l'histoire me bouleversent à chaque fois ☺️ J'avais beaucoup aimé "Lisière" (son premier roman), puis encore plus aimé "L'écho du lac" et avec "Elixir" j'ai eu une gros coup de coeur ❤️ Encore une fois on se retrouve en Bulgarie dans des paysages absolument somptueux qui ont placé la Bulgarie dans le top 3 de mes prochaines destinations de voyage je pense ! On suit le personnage principal qui cette fois est allé dans son pays natal pour découvrir les plantes, leurs pouvoirs, leurs légendes et les personnes qui les manipulent ☺️ Moi qui suis fan de natural writing, j'étais absolument ravie !!! Avec brio, on découvre à quel point les plantes font partie de la culture Bulgare, tout en particulier le peuple Pomak. Les personnages sont attachants, les paysages à couper le souffle (oui on arrive à les voir dans sa tête!) et l'écriture toujours aussi belle ! Je ne pourrais jamais trop conseiller cette autrice à vous et à mes clients! Il s'agit d'une parenthèse enchantée qui vous transporte et vous émeut ! Par contre je préfère prévenir qu'il faut aimer la nature, les descriptions et prendre son temps 😊 On est pas dans un thriller où il se passe 40 000 choses toutes les deux pages, mais je trouve que ce genre de livre peut vous permettre de faire une pause 😉 Je tiens à souligner que la maison d'édition @marchialy a de superbes récits ! Note: ❤️❤️❤️❤️❤️/5 #bookstagrammer #bookstragram #bookreview #livrestagram #chroniquelittéraire #elixir #kapkakassabova #littératureeuropéenne
“Love is a balm…as well as a blade on your neck.” Five Broken Blades by @maicorland is a dark fantasy inspired by Korean myth, culture, and legend. It weaves multiple POVs together until they all collide together. Each person has their own moral code, their own dangerous secrets, and their own agenda and I loved how just when we thought we knew someone something else was revealed. I found each character to be distinguishable and multi dimensional. They each had multiple layers to their personality. They could all be soft and sometimes sweet only to turn around and show how lethal and secretive they can be. It makes them feel real with their own flaws but it also makes it feel like no one can be trusted because while yes each character has their own weaknesses and secrets, there is an underlying vibe that everyone is holding something even bigger close to their chest. This helped the pace keep this quick, sharp, and urgent consistency. I would say this is light fantasy romance. It has some kissing and suggestive moments but it’s all fade to black. I really enjoyed the diversity and LGBTQ+ rep inside the pages. Could I have used a bit more smut with my romance? Duh but hello I’m not gonna hold that against the book as that is just my personal desires. There was a romance between two characters that I didn’t quite enjoy as much but that’s not to say I hated it. I think I just need it to be explored more deeply because it feels more surface level compared to the others. But the little pockets of romance we got was great and brought even more tension into this group of characters. Five Broken Blades was a heart pounding, suspenseful, and twisty high stakes fantasy. I was immediately sucked in and found it hard to put down. This was such a great read and I need book two asap after that ending. Thank you @maicorland, @redtowerbooks, and @entangled_publishing for sending me an arc! 4.5⭐️ 1.5🔥 My “what to expect” & CWs list pinned below in the comments (I ran out of room🤭).
⭐️⭐️⭐️⭐️ - Arranged marriage - Age gap - Single dad - Mafia romance - Possessive MMC - Happy Ending ❤️ I loved this book. Mikhail & Bianca’s story was just perfect ❤️ had a hard time putting this one down. Started off where the first book ended. Check triggers before reading. Can’t wait to read about Sergei 💕 #brokenwhispers #nevaaltaj #kindlereads #bookreview #mafiaromance #bookstagram #kindleunlimited #bookworm #read
📚 BLACK KNIGHT by @author_rina #book #bookstagram #blackknight #xanderknight #bookreview #bookstagrammer #booklover #bookaddict #bookcommunity #bookrecommendations #bookaddiction #trending #rinakent #darkromance #romance #bookclub #bookobsessed #bookaholic #bookreviews
A special post for Dante Maroni, who will always be my favourite! 🥹 #book #booklover #bookstagram #bookaddict #booknerd #bookphotography #bookrecommendations #bookcommunity #ʙᴏᴏᴋᴄᴏᴍᴍᴜɴɪᴛʏ #bookblogger #booklove #booklovers #bookreview #booktok #booktube #booktag #booktoker #booktuber #bookobsessed #dantemarioni #fictionalcharacters #fictionalmenarebetter #fictionalmobs #fictionalmenwrittenbywomen
Would you want the power to see spirits/ghosts? 👻 Would you believe it took me nearly a YEAR to finish this book?? 😂 I read the first 25% last May and shelved it, but finally picked it back up last week because I was desperate to see how it ended. (Summary on the next slide) I honestly didn’t *love* it, though it had some wonderful parts! I thought the plot was quite plain and I didn’t enjoy Signa as our MC — her personality felt inconsistent. I thought Death was a really interesting character though! I enjoyed all their interactions, though perhaps not necessarily the romantic ones? I could use a story just about him and not Signa maybe 😂 The writing was also quite beautiful, especially the descriptions of the setting. I know there’s a sequel — if you’ve read it, would you say it’s worth it for me to give it a shot? 🤔 (After typing this I realized I OWN the sequel 😂) 👉🏻 What’s the longest it’s taken you to finish a book?
Happy Brownie's Day! 💙 Penny is in charge of our review today. 🐰 She has been quite busy reading not one, but two books. Penny is reviewing the first two books in the Life by Pumpkin Series by Leslie Popp. @lesliepoppauthor Book 1. A Cat's View on Everything (2023) Book 2. A Cat's Tale (2024) Penny, please begin. Hello everyone. I am happy to be back on behalf of my brofur Angel Brownie 💙 and my sisfur mentor, Angel Flopsy 🧡 @princess_flopsy_bunny I am honored to review the chronicled adventures and philosophies of a very esteemed gentleman, Pumpkin Popp. I really wish I had met him. Pumpkin was the ruler of a very large domain that included his Meowmy and human family, his four legged siblings, a large army of mice commanded by loyal Mousey, and all humans and beasts as far as the eye could see. He was a benevolent ruler. In fact he was more of a lover than a king. He was a beautiful ginger boy with a heart of gold. 💛 (Swipe) Every word his Meowmy writes about him is full of love and tenderness. Each page speaks of a deep bond in life that has only been enhanced in loss. This little kitty's soul has become part of his Meowmy and she is lovingly sharing him with us. But this is not a sad tale at all!! ~ CARROT 🥕 AND CATNIP 🌱 BREAK ~ Pumpkin's loss is not described in these books, only his love and joy in life. He is alive and well throughout both books! You will laugh at Pumpkin's antics and opinions. For example, he spied a room behind the cold box. He decided to explore it. But, strangely enough he could only walk forward or backward in this room! "Mom, Mom, help me!! I'm trapped! Get the servants and the mouse army to help!!" 🐀🐀🐀 The last chapter in each book is a perfect example of the loving forever home Pumpkin found. But you must read for yourself. 👀 These books are about how much Pumpkin was loved and how loveable he was! My Mommy told me that anyone who has ever loved a fur baby will love these books. Using #cookiesforbrownie I give the Life by Pumpkin Series 🍪 🍪 🍪 🍪 🍪 I loved it! Thank you all! 💙
𝑄𝑢𝑒 𝑙𝑖𝑠𝑒𝑧-𝑣𝑜𝑢𝑠? 📖 Je commence aujourd'hui la lecture de ʟᴀ ɴᴜɪᴛ ᴏᴜ̀ ʟᴇs ᴇ́ᴛᴏɪʟᴇs sᴇ sᴏɴᴛ ᴇ́ᴛᴇɪɴᴛᴇs de @ninegorman et de @marie.alhinho aux éditions @albinmichelstories en lecture commune avec @mel_sagittarius ! Et vous, que lisez-vous? 📚 ᆢ-ᆢ-ᆢ-ᆢ-ᆢ-ᆢ-ᆢ♡ #lanuitoùlesétoilessesontéteintes #ninegorman #albinmichel #kindle #kindlecommunity #booksta #bookstagram #bookreview #cosybooks #coffeeandbooks #bookhaul #bookishlove #bookcommunity #fantasybooks #livrestagram #bibliophilelife #livrestagrammeuse #livresaddict #livresque #readmorebooks #readersgonnaread
ONCE UPON A BROKEN HEART SERIES ❤️🏹🦊📖✨ > The last series you read? Mine is the Once Upon a Broken Heart series and it was GREAT. Once Upon a Broken Heart (4/5 ⭐️) The Ballad of Never After (5/5 ⭐️) A Curse for True Love (1st half 3.5/5 ⭐️ 2nd half 5/5 ⭐️) As for my non spoilery mini review: This series is literally a fairytale but make it a bit more twisted (but not too much). It’s about seeking your happy ending, falling for the morally grey villain-ish mysterious character (hi Jacks). It’s about figuring out yourself and opening up despite the worst than can happen. It’s such a page turner and it will truly teleport you inside the pages. Yes, it’s not the deepest fantasy series ever, but it’s enjoyable and a good distraction from the real world. And that’s what reading is right? Escapism. I’m still a Caraval girly but Evangeline and Jacks have my heart. Kindly and warmly, Maëva <3
⭐️⭐️⭐️⭐️⭐️ “Hope is never bad. In fact, I would argue that it’s as vital to us as the air we breathe.” No one writes ex-military men quite like @authornyssakathryn. Cody was everything I hoped him to be after meeting him in Liam. Harper having someone to watch her back was long overdue after her terrible upbringing and Cody and the rest of Misty Peak were perfect for the job ❤️ Reckless Hope brings us a whole new town with a group of brothers we’ve only gotten glimpses of so far. As with any small town things aren’t as perfect as they seem and trouble is bound to find the Walker boys and their loved ones. I can’t wait to see what is in store for the rest of this series! #bookrecommendations #bookstagram #bookreview #romanticsuspense #booklover #kindleunlimited
◾▪️📖 Book Review 📖▪️◾ THE THINGS WE LEAVE UNFINISHED |Rebecca Yarros 👉🏼 Swipe for synopsis | RATING | ⭐⭐⭐⭐ Gosh! What a journey this book was! Told through two different time periods and two different relationships, there's so much to unpack! Scarlett and Jamieson's love story was absolutely breathtaking. I loved it! You could feel their chemistry and their love for each other on every page. 😍 While Noah and Georgia took a bit of time, understandably. Georgia has some serious baggage she needs to work through and I loved Noah's understanding through it all. I'm impressed with how the two love story's are so woven together. Noah and Georgia working on finishing a book that Scarlett started, based on her own love story with Jamison, was so clever and heart warming. I feel like there were so many layers! While I can see how beautifully written the story is, and the premise that all love is deserved and can look different from couple to couple, I had some small pet peeves with this story. I felt like the book was a little too long. I started to get bored and wanted to just wrap it all up. There was also one scene (after a bombing) that I was confused about. .. how would she be driving on the roads??? IYKYK (message me if you don't!). Overall, I really did enjoy the book and I recommend it, but I didn't love it like her other book. I will absolutely still keep reading Rebecca's backlist as I just love her writing style! 🫶🏼 Shay 💬 Have you read this one? What did you think? ... #book #bookreview #booktalk #bookpost #booklove #bookish #bookcommuntiy #booksta #bookstagram #canadianbookstagram #romance #wartime #rebeccayarros #qotd
Hello #booksta 👋 Aujourd’hui, je vais vous parler d’un format de livre que je ne vous ai encore jamais chroniquer. C’est une nouvelle de Caroline Mertz “La rose de l’espoir”. Je ne vais pas vous cacher que je ne savais pas à quoi m’attendre, ça faisait très longtemps que je n’avais pas lu de nouvelles et les dernières c’était dans le cadre scolaire. Mais comme d’habitude, je n’ai pas été déçu (bon peut-être quand j’ai fini le livre, car je ne voulais quitter l’univers). On commence directement avec de l’action, on est de suite immergé dans le monde de la guerre. J’ai adoré la situation et la mise en place de la rencontre entre Reiner et Aliénor, c’est deux prénoms sont vraiment beaux. Puisque c’est une nouvelle, on voit directement leur rencontre, et ça j’admets que j’ai beaucoup aimé. Puis l’approche entre les deux personnages, Reiner qui tente et Aliénor qui succombe malgré ses résistances. L’histoire avec la rose est vraiment très belle ! Aliénor une petite résistante française qui travaille dans un hôpital, qui combat intérieurement pour ses sentiments. Reiner soldat Aurtichien qui est en réalisté bien plus que ça. Malgré le fait que ce soit une histoire plus courte, je me suis tout autant attacher aux personnages, mes amours ! Ce que j’ai adoré aussi, c'est qu’on arrive vite à l’action une fois qu’ils ont eu une période de répit. J’ai bien pleuré, comme souvent avec Caroline (j’ai un cœur qui ressent tout comme les personnages). Les évènements qui s’enchainent sont juste magiques en émotions ! La vérité, le dénouement, le futur incertain, j’ai englouti les pages. J’ai beaucoup aimé aussi voir plusieurs références à d’autres de ces livres. En bref, c’est encore un sans faute ! Si vous voulez suivre les aventures de Caroline et lire cette nouvelle, inscrivez-vous à sa newsletter pour avoir des informations en avances ! Succombez comme moi aux romans de Caroline Mertz !💙 Bon après-midi, Chloé #Bookstagram #livre #romance #rnouvelle #chroniquelitteraire #bookaddict #livreaddict #books #bookstagramfrance #bookreview #instabook #lesdorys
Reach Us For Excellent Academic Services. Below Are Some Of Our Services; ✓essays ✓statistics ✓finance ✓physics ✓biology ✓physics ✓chemistry ✓algebra ✓calculus ✓maths ✓english ✓history ✓matrix ✓geometry ✓online classes ✓criminology ✓accounting ✓psychology ✓spanish classes ✓rhetorical essays ✓book & article reviews #Assignment #Coursework #Essay #Exam #Homework #Onlineclass #History #Finance #Mathematics #English #Physics #Psychology #Accounting #Criminology #Statistics #Geometry #Matrix #Precalculus #Calculus #Bookreview #Articlereview #Algebra #Spanishclass #college #university #studytips #tutoring #summersemester #studygram #reallogoswriter📚💻🎓
💍Pretty Rings and Broken Things💍 • • • ROUND OF APPLAUSE FOR ARCHER MOORE. Kat Singleton is my favorite author. Hands down. What a work of art. Archer Moore is everything you could want and more. Swooooon. • He falls first, marriage of convenience, enemies to lovers, rival families, billionaire romance, morally grey mmc, grumpy sunshine, touch her and die. • • • #booktok #booksta #bookinsta #bookstagram #bookinstagram #bookish #readwithme #bookreview #bookshelf #goodreads #goodreadschallenge #romancebooks #fantasybooks #fiction #follow #followme #bookishfollowtrain #bookfollow #smutslut #bookfollowloop #kindle #kindleunlimited #amazonkindle #audible #books #smut #bookishfollowloop #bookishfollowtrain #bookishfollow
𝐊𝐨̋𝐯𝐚́𝐠𝐨́ 𝐒𝐚́𝐫𝐚: 𝐇𝐞𝐠𝐞𝐤 🩶🥃🔐🔦👊🏻💵🌇 🤚🏼Le-te-he-tet-len volt! Többször említettem már az oldalamon, hogy valamiért nagyon zavar a magyar könyvekben a főszereplők magyar neve, illetve ha hazai helyeken játszódik. Nem tudom, hogy azért érzek-e így, mert túl valóságosnak tűnik ettől egy történet, de őszintén szólva nem is nagyon kerestem ennek az okát, egyszerűen nem olvastam magyar írótól. Ezért is izgultam a könyv elkezdése előtt, mivel ez volt az első olyan olvasmányom, amit magyar író írt. Ebben a könyvben hálistennek emiatt nem is kellett aggódjak, ugyanis Amerikában játszódik, külföldi szereplőkkel. “Észreveszem a gyűrűt, ridegen csillog a fegyver mellett a kisasztalon. Érdekes milyen különbözőek, számomra mégis ugyanazt szimbolizálják. Mindkettő megöl, csak az egyik kínzóan lassú halált ígér.” 🩶 Egy gyors, pörgős, akció dús és izgalmas történetre vágytam. Ezt mind meg is kaptam, kiegészülve komolyabbnál komolyabb témákkal, és érzelmekkel. Lucia személye, döntései, érzelmei és sorsa szerintem egy olyan történetet mesélnek el, aminek egy-egy részletével (ha nem többel) minden nő tud azonosulni. 🔦Annak aki olvasta és szerette Devney Perry: Indigo Ridge című könyvét nagyon tudom ajánlani ezt a kötetet!😚👌🏽 ❗️𝐓𝐫𝐢𝐠𝐠𝐞𝐫 𝐖𝐚𝐫𝐧𝐢𝐧𝐠𝐬: * családon belüli részletesen leírt erőszak * szëxuálïs bántalmazás * fegyverek használata * verés / erőszak / kínzási módszerek * tudatmódosító szerek használata 𝐱𝐨𝐱𝐨, 𝘱𝘶𝘱𝘢 🏷️ #bookstagram #bookreview #crime #thriller #romance #hungarianauthor #review #aesthetic #books #foryoupage
April wrap-up🍓 In April I finished 6 books, which were a record for me this year!🫶🏼 I read 4 physical books, 1 audiobook and 1 ebook. The audiobook was “Hate Mail” by Donna Marchetti and the ebook, that also was the book club pick was “That time I got drunk and saved a demon” by Kimberly Lemming. It was a pretty good reading month and I am happy that I focused on continuing some series rather than starting new ones⭐️ My favorite one was “Heir of fire” and my least favorite was “That time I got drunk and saved a demon. Hope you also had a good reading month! What was your favorite book of the month? 🫧
Reading time...... #reading #bookstagram #books #book #booklover #read #bookworm #bookish #bookstagrammer #booknerd #bookaddict #bibliophile #readersofinstagram #instabook #love #booksofinstagram #reader #bookaholic #readingtime #bookshelf #writing #booklove #literature #bookphotography #booksbooksbooks #b #author #instabooks #bookblogger #bookreview
Yrsu zbožňujem, ale tu som si spočiatku nebola istá, či budem úplne spokojná. Na začiatku som sa veľa strácala, plietli sa mi postavy a musela som si niektoré pasáže prehrávať viackrát, aby som sa do toho konečne dostala. Avšak v momente, keď do seba všetko zapadlo a príbeh zrazu začal dávať zmysel, som ho už nedokázala zastaviť. Autorka teda ani v tomto prípade nesklamala – podarilo sa jej vytvoriť niečo, čo len tak ľahko z hlavy nedostanem a to nielen kvôli prekvapivým zvratom, ktoré ma doteraz nútia nad dejom dookola rozmýšľať. Väčšinu času som vôbec netušila, čo si mám o postavách myslieť. Na jednu stranu mi prišli podozrivé úplne všetky, na druhú stranu som si za žiadnych okolností nedokázala predstaviť, že práve títo ľudia by do toho mohli byť nejakým spôsobom zapletení. A tak som tápala, uvažovala, znova tápala a v neposlednom rade zhromažďovala kúsky skladačky, ktorá mala všetko vyjasniť. Nuž a Klára Cibulková už k Yrse prosto patrí, ja si ju bez nej neviem ani predstaviť. Ďakujem @grada_sk , počúvala som v aplikácii @audiolibrix . 🤍 #gradask #audiobook #audiolibrix #audiokniha #yrsasigurdardottir #hrob
✨️This month's @thebookishbox unboxing Includes ✨️ - Special Edition digitally signed #Gothikana book - Gothikana Sticker - #CrescentCity inspired socks - #Rhysand / #Velaris pin - Bookish Sleep Mask - Cork Board - Annotation Overlays This was such a great box! I'm excited to read Gothikana, and I love all the goodies I got 😍
Do No Harm by Jack Jordan - I gave this 4⭐ I first heard about this book before its release and loved the idea of it. I love medical dramas and thoroughly enjoy thrillers - this book hit that spot and I couldn't put it down. This really had you on the edge of your seat and you didn't know what to expect next. I liked how it had different POVs that really added so much depth to the story. If you haven't read this yet I highly recommend! #booksbooksbooks #books #bookstagrammer #bookstagram #bookstagrammers #bookstagramuk #bookstagramuk🇬🇧 #booksbooksbooks📚 #booksbooksandmorebooks #bookreview #bookreviewer #bookreviews #bookpublishersnetwork #book #booklover #donoharmbook #jackjordan
💫💛 👩🍳🎾 Book Review 🎾👩🍳 Elle is down on her luck having lost her job recently She takes a job as chef for pro tennis player Nicky when he is in London to play at Wimbledon. ✨Contemporary Sports Romance ✨Forced Proximity ✨Work place romance : He is her Boss ✨First person POV ✨Slow burn ✨Lots of yearning and angst ✨Secret relationship & hookups ✨Spicy I really enjoyed this book & couldn’t put it down. It’s not often I read books with a FMC like Elle where I felt the depths of the emotions she is going through and @emmarae.author style of writing really captured that for me . I felt the pain , love , yearning , the self doubts everything she goes through 🥹. Coming off a relationship with a selfish partner and being in close proximity with someone who sparks your flame and gives you the attention and the luv you deserve and have never had . Several times I had to stop and think and ask myself what would I do in this situation. This was a romance book but I think it was also a lot about personal growth & self discovery for Elle There are instances where Nikky seems to be taking advantage of her cause she is accessible to him, he could have taken charge earlier of his own life and relationship. I like that he evolved as well & had the opportunity to be with someone who saw him truly. I was rooting for their love through out controversial I know, but true love always wins. I ❤️ the attention & focus he gives to her. 😮💨.The spice was 🫠 I wish it was dual POV as with so many emotions and moving parts would have been great to have Nicky’s pov to see things from his perspective and how he navigated the relationship building, what was going through his mind regarding Elle. I ❤️Josie she was the voice of reason the story needed and that support factor for Elle. She was hilarious with her direct approach. She needs her own book. This book is now part of my guilty pleasure list and will be grouped with Scandal (tv series) Something borrowed (Book & Movie)which are my absolute faves ❤️ Love game is out on 16th May. This was an arc copy so all are comments are of my own views and opinion. Thank you @emmarae.author @hera_books @netgalley
Akú dobrú romantickú knihu ste za poslednú dobu prečítali?💜 ▪️ Názov: Twisted Love🩵 Autor: Ana Huang👩🏻 Počet strán: 359📜 ▪️ Nebudem klamať, do tejto knihy som nešla s malými obavami, ale s obrovskými. Ak ma sledujete dlhšie, môžete vedieť, že ja a spicy scénky v knihách nejdeme veľmi dokopy. Plus natrafila som na veľa recenzentov, ktorí buď knihu úplne milovali alebo nenávideli, preto som sa fakt bála, či moje spontánne rozhodnutie si celú sériu kúpiť nebolo moc vedľa. Ale táto kniha...táto kniha bola niečo úplne iné. Nebudem klamať, Alex Volkov ma ďaleko od dokonalého muža, teda jedine ak hľadáte príliš ochranárskeho, chladného muža, ktorý bol fakt niekedy moc, ale možno to ho v tejto knihe robilo tak dokonalého? V realite by som od neho utekala na míle ďaleko😅, no pre Avu, bol dokonalý. Dobre, úprimne, keby bol niekto mnou rovnako posadnutý a zamilovaný do mňa tak ako Alex počas knihy do Avy tak by som tiež padla na kolená. ▪️ Vieme, že romantika je základom tejto knihy, a preto som ostala prekvapená, ako sa romantika zaujímavo preplietla s ďalšími zápletkami a ako to dokonale zapadlo do seba a urobilo z knihy komplexné dielo. Kniha sa čítala sama a ja som pri nej cítila viacero emócií a párkrát ostala prekvapená scénkami a tým, kam sa príbeh uberal. Autorka ma naozaj skvelý ľahký štýl písania, ktorý vám ulahodí. No aj tak nečakajte nič iné okrem trochu spicy romantiky, ktorá bude slúžiť na oddych po celom dni, nie je to niečo prevratné z čoho budete na zemi, ale svoj účel to plní💜! A tiež odporúčam ísť do toho s tým, že neviete skoro nič, pretože takto vás kniha bude baviť oveľa viac! ▪️ 4/5✨️ ▪️ Bola to úžasná oddychovka a som rada, že som knihu neprehliadla a celú sériu si zaobstarala. Je to niečo k čomu si rada spravím kávu a vyložím nohy. Som veľmi zvedavá na ďalšie knižky z tejto série💜!