Saturday night fakeaway - beef & broccoli in oyster sauce with extra speed; babycorns, carrot & green pepper - lovely rich flavours & very filling too ππ #saturdaynightfakeaway #fillingfood #tastyfood #homecooking #loveastirfry #healthyfood #easyrecipes #lovemyfood #dietwhatdiet #slimmingworldmember #slimmingworldweightloss #slimmingworldlifestylechange #slimwithhannah #loveslimmingworldfood #yesyoucanwithslimmingworld
Wow!! I'm not even sure how its 8.15pm!!! My husband is back to work tomorrow so him and the kids had a takeaway, I didn't fancy one so made a fakeaway instead! Noodles, veg, bacon and old faithful mayflower curry sauce! . . . #saturday #saturdaynight #fakeaway #saturdaynightfakeaway #mayflowercurry #mayflowertastesgood #noodles #chowmein #calories #caloriecounting #lowcaloriemeals #caloriedeficit #myfitnesspal #mindfuleating #healthierandhappier #healthy #healthyfood #healthyeating #healthyeatinghabits #fooddiary #weightloss #weightlossjourney #weightlosssupport
πSATURDAY NIGHT FAKEAWAY π Saturday night fakeaway tonight was smash burger with slimming world wedges, homemade burger sauce and carrot sticks for speed intake #slimmingworld #slimmingworldfood #slimmingworldjourney #weightloss #weightlossjourney #saturdaynightfakeaway #foodoptimising #foodoptimisingworks
Yay - proper SW cooking is back! β¦. After a nightmare house move followed by a week away it feels goodβ¦.. tonight Iβve done a double open burger using just 5% minced beef and @jdseasonings Burger Blend (Use code JT20 for 10% off all of their spice kits), the burgers are sitting on top of a @warburtonsuk protein thin bagel for my heb with onion, tomato, lettuce and 1tblsp of @crucial_sauce Burger Sauce for 2syns. All served with SW chips πππππππ #swuk #saturdaynightfakeaway #saturdaynightslimmingworld #sw #slimmingworlduk #slimmingworldrecipes #slimmingworld #slimmingworldjourney #slimmingworldfood #slimmingworldburgerandchips #slimmingworldburgernight
18.5.24 Tortilla Crust Chicken Strips π½οΈππ #homemadefood #tortillachickenpitta #saturdaynightfakeaway #crispychicken #airfryerrecipes #tastyfood #easydinner
Getting back on track after a week away in Crete; Saturday night fakeaway Balti chicken curry with spinach & tomato & pilau rice - very filling, tasty & just the right amount of spiciness π All Syn free too π #saturdaynightfakeaway #loveacurry #fillingfood #tastyfood #homecooking #slimmingworldmember #slimmingworldrecipes #yesyoucanwithslimmingworld #lovemyfood #dietwhatdiet #slimwithhannah #loveslimmingworld #weightlossfeelsgood #loseweightforgood #fillyourplatelosetheweight #healthyfood #slimmingworldfoodie
Im a fairly confident cook, but I would have never taken on Brioche rolls. Enter the TM6 and Iβve just found out how easy brioche rolls are to make at home! Itβs a bit cool in old Melbourne town tonight so I used the ferment mode (37Β°C), the varoma and the silicon baking mat to help prove the dough. Brioche recipe from Cookidoo. Hot and spicy chicken burger fillets and pepper mayo sauce from @skinnymixer #dinners2. Cooked by me! #tm6 #thermomixaus #saturdaynightfakeaway #homemade
You really canβt beat a fakeaway on a Saturday night! Chicken curry using the SW frozen chip shop curry sauce. Salt and pepper chips on the side, very tasty, not a syn in sight! #slimmingworlduk #foodoptimising #slimmingworldfreefood #slimmingworldmember #saturdaynightfakeaway #saltandpepperchips #weightlossjourney
#saturdaynightfakeaway #meatfreechicken from @richmond_foods with #stirfryveggies #rice #sweetandsoursauce #soysauce #food #foodie #foodaddict #tasty
#fooddiary #saturdaysfood #saturdaynightfakeaway #slimmingworld #foodoptimising 4.5 syns for the colmans sachet #swquornkebab #weightwatcherswraps #healthyextrabchoice #fetacheese #healthyextraachoice #pastasalad #crabsticks #hashbrownwaffles 1 syn each # #breakfast #healthylifestyle short run today ahead of the Bristol 10k #bodymagic #runninginmemoryofmikey #mikeysworld #swconsultant #swinsta #swtargetmemberπ―
π©· DINNER π©· Chicken curry, rice and naan bread π€€π€€π€€ Using the mayflower curry powder with chicken, mushroom and onion, plain boiled rice, garlic naan bread and side salad π€€ better than a takeaway π€€ π©· curry ~ 4 syns π©· naan bread ~ 7 syns π©· everything else ~ free and speed #fakeawaysaturday #mayflowercurry #chickencurry #saturdaynightfakeaway #myweightlossjourney #slimmingworldmyway #healthyeatingideas
Saturday Night Fakeaway - Our favourite Pinch Of Nom fakeaway recipe Yeung Chow Fried Night π. #slimmingworldjourney #slimmingworld #pinchofnomrecipe #pinchofnom #healthyeating #weightlossjourney #saturdaynightfakeaway #dietfood #yummyfood #losingweight
Surf and turf in a garlic butter (2syns) Mushrooms and vibe tomatoes and homemade garlic salt chips ... #surfandturf #steaknight #saturdaynightfakeaway #slimmingworldmember #slimminginsta #slimmingworldjourney #slimmingworlddinner #slimmingworldtargetmember #slimingworlduk #weighlossgoals #weightlossdiary #weightlosstips #weightlossjourney #weightlossdiet #weightlossrecipes #weightlossresults
Saturday Strength ππ½ββοΈ Fab full body sesh in the gym this morning, followed by a busy day of sorting the garden ready for summer π Knackered now after refuelling with a monster burger! Five guys who? πππ€€ #kimfrench #kimfrenchfitness #believebykimfrench #resetandrebuild #power #8weekchallenge #fitnesschallenges #fullbodyworkouts #fullbodystrength #strengthtrainingforwomen #weighttrainingforwomen #weightlift #resistancetraining #musclebuildingplan #gymfitness #gymdays #gymgirls #gymselfies #ο¬tness #fitnessjournal #ο¬tspo #fitmumuk #strongmum #saturdaynightfakeaway #smashedburger #applewatchultra #saturdaystrength #saturdaysesh #weekendworkout #womensbest
My favourite pizza - butter chicken on a low carb wrap ππΌ β’ β’ β’ #keto #ketoaustralia #ketodiet #lchf #ketoforlipedema #lipedema #lipedemafighter #ketolife #ketolifestyle #ketoliving #ketocommunity #ketofriendly #ketofood #ketomeals #ketodinner #ketopizza #lowcarbpizza #lowcarbwrap #butterchicken #butterchickenpizza #saturdaynightfakeaway #pizzanight #fakeaway #keepingitketo
Chinese fakeaway! π«ΆπΌ β’ Salt and pepper chicken~ I used 5 chicken dippers(1.5 each), while they were cooking in the oven I fried onions, peppers, chillis, kerala Chinese salt and chilli pepper seasoning from @homebargains and chilli flakes, I added the nuggets and mixed if all together. Homemade chips~ I cut a potato and covered in oil(2 per tsp) and cooked in the oven for half an hour. Egg fried rice~ I boiled rice, once boiled I added to a pan with soy sauce and an egg & mixed all together. Curry sauce~ I used 28g mayflower Chinese curry sauce(4), mixed with water and poured all over. 15 syns 883 cals (approx) #saltandpepperchicken #swsaltandpepperchicken #swchinese #swfakeaway #fakeaway #fakeaways #fakeawayfriday #fakeawayslimmingworld #fakeawaychinese #chinesefakeaway #eggfriedrice #rice #currysauce #chinesecurry #saltandchillichicken #chinesecuisine #swdinner #swdinnerideas #swdinners #swlunchbox #slimmingworlddinner #slimmingworldfakeaway #slimmingworldchinese #saturdaynight #saturdaynighttakeaway #saturdaynightfakeaway #saturdaynightfakeawayπ #swsaltandpepperchickenfakeaway #homebargains #chinesefood
β Dinner β Hunters chicken sausages made with the Heck chicken sausages at 0.5 syn each, I had 4 sausages, so 2 syns. Garden peas, mushrooms, and homemade wedges tasted amazing π I used a mixture of mature cheddar and mozzarella, which was both of my Healthy Ex A's #slimmingworld #slimmingworlduk #slimmingworldjourney #newtoslimmingworld #slimmingworldmafiauk #weightloss #slimmingworldfamilyuk #weightlossjourney #slimmingworldinstagram #foodoptimisingworks #slimmingworldmembers #slimmingworldonplan #saturdaynightfakeaway #heckchickensausages
β Monday Morning Breakfast β Muller light orange, with dark chocolate sprinkles 0.5 syns, with strawberries and blueberries π #slimmingworld #slimmingworlduk #slimmingworldjourney #newtoslimmingworld #slimmingworldmafiauk #weightloss #slimmingworldfamilyuk #weightlossjourney #slimmingworldinstagram #foodoptimisingworks #slimmingworldmembers #slimmingworldonplan #saturdaynightfakeaway
β Saturday Night Fakeaway Pizza β I used the wholemeal soft pitta bread for my healthy Ex 'B' choice, cheese for one of my Healthy Ex 'A' choice, and I made my own chips! Side salad for a bit of speed, I also had red onion, peppers, and pepperoni, which was 3 syns. #slimmingworld #slimmingworlduk #slimmingworldjourney #newtoslimmingworld #slimmingworldmafiauk #weightloss #slimmingworldfamilyuk #weightlossjourney #slimmingworldinstagram #foodoptimisingworks #slimmingworldmembers #slimmingworldonplan #saturdaynightfakeaway
#saturdaynightfakeaway While watching the #eurovision π€©π€©π€©π€© Sweet n Sour @quorn_uk How I make my Sweet n sour sauce Ingredients 200ml pineapple juice 1 tbsp of canderel 4 tbsp @skinnyfoodco tomato sauce 1 tbsp cornflour 3 tbsps of red wine vinegar #dinnerdoneright #dinnerideas #dinnerrecipes #dinnertime #yum #CalorieCounting #healthy #nutritious #nutritiousanddelicious #getinmabelly #yummy #pretty #goodfats #healthyfat #slimmingworld #slimmingworldjourney #slimmingworlduk #slimmingworldinsta #WeightLossJourney #weightlosscommunity #weightlosstransformation
Late breakfastβ¦.. pancakes π₯ made with milk π₯ part HEA egg π₯ oats and half banana π with strawberries π blueberries π« and rest of banana π on top with 8 syns Nutella π° Dinnerβ¦.. Air fryer pizza π my take on Texas BBQ, 18 syns on the self raising flour rest of my HeAs π§ in stuff crust and mozzarella, 3 syns on BBQ sauce, peppers π« red onion π§ and chicken π on top. So delish π€€ #slimmingworld #slimmimgworlduk #airfryerpizza #stuffedcrust #texasbbq #saturdaynightfakeaway #sw #swuk #swinsta #slimmingworlduk #slimmingworldsurvival
TACO BOWL π β’ We had a lush Taco Bowl this evening using beef mince, salad, rice and sour cream it was delicious thanks @j.luxe.fit_ for the inspo π β’ β’ β’ #tacobowl #tacobowlsalad #fakeaway #taco #boiledrice #tacolover #tacosalad #beefmince #sidesalad #saturdaynightfakeaway #caloriecountingnutracheck #caloriecounting #caloriecountingjourney #caloriecountingmeals #caloriecountingblogger #caloriecountinguk #caloriecountinginstagram #caloriecountinginsta #caloriecountinginspo
Saturday night fakeaway, Chicken Ruby from the Dishoom cookbook #homecooking #homecooked #fakeaway #saturdaynightfakeaway #dishoomcookbook #dishoomrecipe #foodie #foodiegram #foodieofinstagram
Homemade Donner Kebab wrap π 28 syns for the whole thing , can be split between 3/4 people, ww wrap hex b, fat free Greek yoghurt with mint sauce for dressing! Perfect saturday night fakeaway β€οΈ #fakeaway #donnerkebab #saturdaynightfakeaway #betterchoices #betterthantakeout #slimmingworldworksforme #sw #slimmingworld #slimmingworldweightlossjourney #slimmingworldfriendly #slimmingworldfoodblog #slimmingworldlife #slimmingworldlifestyle #slimmingworldsuccess #slimmingworldmembers #slimmingworldweightlossdiary #slimmingworldfamilyuk #swinsta #ownmyjourney #onplan #myjourney #slimmingworldworks #slimmingworldmeals #slimmingworldthursdayweighday #doingitforme #slimmingworldbolton #slimmingworldmafia8
Saturday night fakeaway chicken shashlik from Pinch of Nom #fakeaway #saturdaynightfakeaway #pinchofnom #homecooking #homecookedmeal #chickenrecipes
Greek night last night. These are all from Lidl. Really easy and tasty with a bit of side salad. I think the vegetable rice and the kebabs were my favourite #greekfood #greeknight #fakeaway #fakeaways #lidl #lidlgreece #saturdaynight #saturdaynightfakeaway
Beef with Broccoli - recipe from Stir-Frying to the Skyβs Edge by Grace Young. Served with noodles and accompanied by a 0% Erdinger. #saturdaynightfakeaway #chinesefood #soberlife #zeropercentalcohol
Saturday night fakeaway tonight was Salt & Pepper chicken with a veg stir fry - got the ready prepared frozen chicken in Meat Mart in Wigan (1.5 syns for 100g) Very tasty, filling, spicy & easy dinner with lots of Speed food too ππ #tastyfood #saturdaynightfakeaway #fillingfood #speedydinnerideas #speedfood #easydinner #lovemyfood #dietwhatdiet #slimmingworldmember #loveastirfry #lotsofveggies #slimmingworldlifestylechange #slimmingworldweightloss #slimmingworldfoodie #homecooking #healthyeating #slimwithhannah #fillyourplatelosetheweight #loseweightforgood #yesyoucanwithslimmingworld
DINNER - Doner Kebab using 5% beef mince and @jdseasonings Doner kebab seasoning. Served with air fry chips using JD seasonings chips and wedges seasoning, lettuce, cabbage, carrot and coriander slaw and @warburtonsuk wholemeal soft pitta (HeB) . #slimmingworld #swfoods #slimmingworldjourney2024 #slimmingworld2024 #slimmingworldfooddiary #slimmingworldfriends #slimmingworldfamily #slimmingworldsupport #slimmingworldjourney #slimmingworldfood #slimmingworldmeals #slimmingworldinstagram #foodoptimising #slimmingworldmealinspiration #swchoosesuccess #swfriends #slimming #slimmingworldrecipesuk #swfoodblog #swfoodblogger #swblog #swblogger #swnewstart #swdinner #swdinnerideas #fakeaway #donerkebab #jdseasonings #saturdaynightfakeaway
Doner Kebab Meat on a Flame grilled Baked Greek style flat bread 608 calories Happy Saturday night Fakeaway β€οΈ #fakeaways #saturdaynightfakeaway #saturdayvibes #nutracheck #myweightlossjourney
Attempted the Chip Shop style chips suggested by @kitchensanctuary but in the air fryer- BEST. CHIPS. EVERβΌοΈ Will definitely be doing them like that again ππΌ Paired with @lidlgb battered Cod fillets, mushy peas and a side of @skinnyfoodco Chip shop curry sauce π #chipshopchips #fakeawaychippy #fishandchips #saturdaynightfakeaway #fakeaway #fakeawaychipshop
π©· DINNER π©· Big mac wrap and french fries π€€π€€π€€ This was awesome and abit different to how i normally do the wraps Using mince beef to make the burgers and then cook how you normally would, then sort the wrap...on one side place a cheese slice, burger sauce, lettuce and gherkins and on the other side place a cheese slice and sauce, once the burger is cooked place that on top of the lettuce, fold the sides in and then fold into a taco, place into a frying pan until toasted on both sides then serve with whatever you fancy π i had homemade airfried french fries just to give off #mcdonaldsvibes Only thing i would different is make the burgers smaller π€£ π©· wrap ~ HEB π©· cheese ~ HEA π©· sauce ~ 3 syns π©·everything else ~ free and speed #saturdaynightfakeaway #mcdonaldsfakeaway #bigmacwrap #frenchfries #burgerandchips #amysswjourney #slimmingworldmyway #slimmingworldmyweightlossjourney #weightlossjourneyuk
Another Saturday night fakeaway! Spicy chicken and spinach protein wrap pizza and sweet potato fries π #saturdaynightfakeaway #pizza #instafood #healthychoices #countingcalories #pcosweightlossjourney #foodies #slimmingworld #healthyfood #healthandwellness #weightloss #pcosdiet #thatsawrap
Dominoβs Fakeaway Although Still High In Calories, Itβs A lot Less Then Dominos! Tasted So Good And Enjoyed Making Homemade Pizza. Total Calories 1232 #saturdaynight #saturdaynightfakeaway #fakeaway #calories #caloriescaloriescalories #caloriecountingdiary #caloriecountingnutracheck #nutracheck #slimmingworld #slimmingworlduk #slimmingworldsupport #slimmingdown #pizza #pizzalover #pizzapizzapizza
Trying sw from homeβ¦ again π€¦πΌββοΈ Day 1 Dinner Chicken Kebab, wholemeal pitta HeB, air fryer tinned new potatoes, salad, garlic sauce 6 syns . . #slimmingworlduk #slimmingworld #saturdaynightfakeaway #weightloss #letstryagain #chickenkebab #day1dinner
New recipe alert. *STICKY SESAME CHICKEN* Saturday fakeaways donβt need to be unhealthy or boring. I found this recipe from the @myprotein website and it turned out incredible. The sticky sesame sauce really added a lot of flavour to make it a brilliant dish. The process is 5 very simple steps. With each part being laid out on the my protein website. I give this a rating of 8.5 out of 10. I reckon I can get this better moving forwards but practice make perfect #saturdaynightfakeaway #myproteinrecipes #stickysesamechicken #gordanreturns
π©· DINNER π©· Chicken kebab fakeaway π€€π€π€€π€π€€π€ Chicken has been marinating all day in ff greek yogurt, garam masala, cumin, paprika, garlic and abit of salt, it gives off the real takeaway vibes π€ I served mine with salad, cheese, pitta and mayo, i do normally have chips too but i just didnt fancy any this time π©· pitta ~ 8 syns π©· mayo ~ 1 syn π©· cheese ~ HEA π©· chicken ~ free π©· salad ~ speed If asda didnt sub my HEB pitta then this would of been alot lower on syns lol #saturdaynightfakeaway #fakeawaynight #chickenkebabfakeaway #chickenkebab #takeawayvibes #amysswjourney #weightlossmealideas #mealideasforweightloss #slimmingworldmyway #slimmingworldmyweightlossjourney #fooddoesnthavetobeboring #healthymeals
Favourite Saturday Night dinner. The @sylvestersweeneypt Chicken Chasni. Love it! So yummy. #saturday #saturdaynight #saturdaynightdinner #saturdaynightfakeaway #yummy #yummyfood #homecooked
Saturday night #fakeawaychinese Beef and Broccoli with Oyster sauce, Sesame Prawn sausage roll, fresh deep fried prawn crackers , Hoisin Ribs, Chicken Chow mien, there was salt and pepper squid but forgot to take photos π€£π #saturdaynightfakeaway #beefandbroccoli #beefandoystersauce #chickenchowmein #seasameprawntoast #tkccooking #tonyskitchencooking #cookingstix
π₯ LAST NIGHTS DINNER π₯ Now this was a perfect Saturday night Fakeaway ππ» We had @spicentice Turkish doner kebab (π) with speedy salad, potato wedges tossed in @spicentice seasoning and a wholemeal pitta (I had my HExB for breakfast so this was 6.5 syns). Honestly this was DELICIOUS and sooooo easy to makeβ¦ swipe β‘οΈ to see π Dessert I had speedy strawberries and free filling grapes βπ» βΌοΈ SAVE 20% with @spicentice using my code CSSW20 at checkoutβΌοΈ all π on @slimmingworld plan and so easy to make delicious meals, never feel like your missing out on weekend treats ππ» #slimmingworld #slimmingworldmafia #slimmimgworlduk #slimmingworldnewbie #slimmingworldmember #slimmingworldmeals #swmember #sw #swukfood #foodblog #weightloss #weightlossjourney #slimmingworldjourney #slimmingworldjourneyuk #slimmingworldjournal #slimmingworlddinner #slimmingworlddiary #speedfood #foodoptimsing #weightlosstips #weightlossinspiration #syns #lowsyn #healthyextras #fakeaway #saturdaynightfakeaway #ad #affiliate
Love a fakeaway π Sweet and sour chicken using @slimmingworld @icelandfoods ready made sauce (f). 5 syns for the @sainsburys vegetable spring rolls and I used @jdseasonings chips and wedges spice mix on the chips (f) #saturdaynightfakeaway #saturdaynight #chinesefakeaway #slimmingworld #lowsynmeals
Still doing my best to stay on track & get back to my target weight before my jollies π Andalusian meatballs, pasta & wing it sauce with passata, plum tomatoes, onion, garlic & spinach tonight - all free, tasty, filling & plenty of speed too ππ #meatballrecipe #tastyfood #fillingfood #yesyoucanwithslimmingworld #saturdaynightfakeaway #slimmingworldmember #slimmingworldrecipes #slimmingworldlifestylechange #slimmingworldfoodie #slimmingworldweightloss #loseweightfeelgreat #fillyourplatelosetheweight #weightlossjourney #lovemyfood #dietwhatdiet #slimmingworldworks #homecooking #healthymeatballs #healthyfood
When you've no idea what you've dug out of your freezer but discover it's a favourite Chickpea & Sweet Potato curry! Added spinach for extra speed too! π π πππΌππ»πΈππ π πΈπ πβπΌ βππ½ππΌ βπΈππ, βπΈππΌπππβπβ β°οΈ π‘.ππππ, π.ππ & ππ‘π βοΈ πππ₯π πΉππ§ - πππ‘ππ π ππ‘π‘π‘π #slimmingworld #slimmingworldmember #slimmingworldlife #slimmingworldfamily #slimmingworldconsultant #foodoptimising #slimmingworldfollowers #slimmingworldworks #swmotivation #swinspiration #curry #healthymeals #healthyliving #saturdaynightfakeaway #slimmingworldconsultant #swmafia #swinsta #swfollowers #swfollowersuk #weightloss #loseweight #halesworth
Chicken Karaage from the Gousto files. I agreed to cook if he got me a Cinnamon Swirl Blondie from the dessert parlour π€ #GoustoRecipe #ChickenDishes #tweakedforslimmingworld #slimmingworld #fakeaway #saturdaynightfakeaway #foodie #dinnerinspo #sushirice #tenderstembroccoli #crispyonions #chickenkaraage
CHINESE FAKEAWAY β₯οΈ @jdseasonings Chinese chicken curry, salt & pepper chips with egg fried rice and prawn crackers β₯οΈ Use code AMYC20 to save 10% @jdseasonings #affiliate #jdseasonings #jdseasoningsrubsandmealkits #jdseasoningsdiscount #jdseasoningsfakeaway #fakeaway #saturday #saturdaynightfakeaway
Anyoneβs elseβs child refuse to eat the same food as you but then decides they actually prefer your food ? π€£ Anyway , @cardiff.mum , your Sticky Honey & Orange chicken has won over my fussy teenagerβ¦ another meal to add to the list where everyone will eat the same meal π . . . #saturdaynightfakeaway #stickychicken #chinesefakeaway #airfryerrecipes #easydinners #familydinners #dinneridea #weightwatchersuk #weightwatchers #weightwatchersworks #weightwatchersmeals #wwukfooddiary #wwukambofficial #wwukfood #wwukinstagram #foodstagram #foodie #orangechicken #cardiffmums
I can't do crazy stuff with basic peopleπ Follow @why_not_manii #saturdaynight #saturdaynights #saturdaynightlive #saturdaynightfever #SaturdayNightShenanigans #saturdaynightin #saturdaynightout #saturdaynightfun #saturdaynightvibes #saturdaynightlife #saturdaynightparty #saturdaynightlights #saturdaynightspecial #saturdaynightdinner #saturdaynightcraftalong #saturdaynightworkout #Saturdaynightselfie #saturdaynightshow #SaturdayNightsIn #saturdaynightturnup #saturdaynightsarefortheboys #saturdaynightbelike #saturdaynightfood #saturdaynightinnyc #saturdaynightsnuggles #saturdaynightfakeaway #saturdaynightwrist #saturdaynightrager #saturdaynightsalright #SaturdayNightKaraoke
Saturday night fakeaway! Chicken with green peppers, mushrooms and mixed vegetables with a tbsp each black pepper sauce (1 syn) soy sauce and 150ml beef stock. Served with homemade egg fried rice. Delicious! #slimmingworld #slimmingworlduk #swinsta #swinspo #fakeaway #saturdaynightfakeaway #lowsyn #lowsynmeal #lowsynmeals #sayyestosucess #yesyoucan #yesyoucanwithslimmingworld
Chicken jalfrezi - Saturday night fakeaway #saturdaynightfakeaway #fakeaway #fakeawaysaturdaynight #homecooking #homecookedmeals #homemadecurry #chickenjalfrezi
π©· DINNER π©· Chinese fakeaway π€€π€€π€€π€€ Chicken curry, beef in black bean sauce, egg fried rice and prawn crackers. π©· curry ~ chicken, mushrooms, onion and i used the #mayflowermediumcurry for the sauce (packaging on last photo) ~ 5 syns π©· black bean ~ beef, onion, pepper and i used #mayflowerblackbean for the sauce (packaging on last photo) ~ 3 syns π©· rice ~ cold rice fried and mixed with egg and soy sauce ~ free π©· prawn crackers ~ 4 syns #chinesefakeaway #saturdaynightfakeaway #amysswjourney #slimmingworldfakeaway #onplanfakeaway #weightlosscommunityuk #mealideasforweightloss #weightlossmealideas #mayflowersauce #chinesefoodlover #weightlossblogger #foodiegram #foodbloggersofinstagram
Tried the @jdseasonings burrito seasoning for the first time last night and it was so good! I used less than 3% fat beef mince from @aldiuk along with their Mexican style rice. The recipe was so easy to follow for the burrito even though my folding of it needs some work π€£ Iβm currently on slimming world so this 0 syn seasoning is essential to me right now. I used the WW wrap as my HEx B and some melted cheese as my HEx A. The only part of my meal that I needed to syn was the rice at only 1! ππ». Syn free sweet potato fries and veggies made this meal super filling. #slimmingworld #tastyfood #jdseasonings #burritosπ― #fakeaway #aldi #homecooking #healthyextrassw #saturdaynightfakeaway
Saturday night dinner looks pretty bland, but it was actually really nice. 4 x chicken tempura strips from @aldiuk, @veetee_official sticky rice and @mayflowertastesgood curry sauce all for 6.5 syns. No speed but it's Saturday night, right?! #saturdaynightfakeaway
β‘ Chicken Tacos & sides β‘ L U S H. .......& some random ribs on the side as @asda sent them as a substitute for chicken Tinga??? Which was meant for the tacos. Popped to the @coopuk for some chicken & taco seasoning. Sorted. Long journey today. We were up & out early, skipped breakfast so treated ourselves to a pub lunch stop in Llanidloes, which was lush. Nice to be home. 3 loads of washing done food shop delivered & packed away..... Ready for a full day out at a rugby tournament tomorrow π«£ #taco #taconight #tacosfordinner #chickentacos # #saturdaynightfakeaway #saturdaynightfood #saturdayfakeaway # #fakeaway #mexicanfood
Chinese style chicken curry, sauce packed full of veggies and served with fluffy boiled rice. #FromScratch #ChineseChickenCurry #SaturdayNightFakeaway
Fancy a pizza? You can still have one! This is a ww wrap (b choice), cheese (a choice) and free food meats, onions and peppers. You can even pick it up like a pizza π DELICIOUS!! #saturdaynightfakeaway #pizza #onplan #slimmingworldconsultant #slimmingworldjourney
Tea tonight was defo need and ready for, Turkey chilli sticky mince with rice and some Sriracha crackers π₯ All for 556 kcal, #lowcalorie #saturdaynightfakeaway #lowcaloriehighprotein
I really fancied a curry tonight, so used up my leftover lamb (which I'd frozen) in this @slimmingworld Lamb Rogan Josh recipe, which was sooooo good & completely free too! Hubby must have had at least 30 + syns for his Naan bread but I resisted! Definitely one to do again! Come along & we'll tell you how you can enjoy all your favourite food Slimming World friendly..... π πππΌππ»πΈππ π πΈπ πβπΌ βππ½ππΌ βπΈππ, βπΈππΌπππβπβ β°οΈ π‘.ππππ, π.ππ & ππ‘π βοΈ πππ₯π πΉππ§ - πππ‘ππ π ππ‘π‘π‘π #slimmingworld #slimmingworldmember #slimmingworldlife #slimmingworldfamily #slimmingworldconsultant #foodoptimising #slimmingworldfollowers #slimmingworldworks #swmotivation #swinspiration #freefood #healthylifestyle #curry #favourite #free #fakeaway #saturdaynightfakeaway #slimmingworldconsultant #swmafia #swinsta #swfollowers #swfollowersuk #weightloss #loseweight #halesworth
Per- peri chicken burger with mozzarella in a flat bread π₯° Calories 595 Carbs 52.5g. Fat 14.9g. Protein 63.6g #saturdaynightfakeaway #fakeaways #highprotein #highproteinmeals #healthylifestyle #healthyfood #macros #macrosonpoint #buildinghealthyhabits
Saturday night is fakeaway night π gyros for tea tonight π #fakeaway #saturdaynightfakeaway #lowcaloriefakeaway #fakeawayrecipes #fakeawayideas #greekfakeaway #gyros #greekgyros #greekfood #homemadegyros #homecookedmeal #saturdaynightcooking #lowcaloriemealideas #lowcaloriediet #lowcalorierecipes #whatieattoloseweight #watchingwhatieat #healthierchoices
Saturday night dinner...smash burgers and salad! 528 calories and 50g protein I added more jalepenos after I took the photo..I can't get enough of them π #saturdaynightfakeaway #fakeaway #smashburger
π©· DINNER π©· Mayflower sweet and sour pork with boiled rice and roasted carrots π€€ These sauce pots are so awesome and do really taste like a real chinese takeaway π€€ #sweetandsourpork #mayflowersweetandsour #chinesefakeaway #saturdaynightfakeaway #amysswjourney #weightlosscommunityuk #weightlossmealideas #mealideasforweightloss
@aldi tempura chicken strips (31g = 1syn), @mayflowertastesgood curry sauce (100g = 4 syns) and egg fried rice. #saturdaynightfakeaway #saturdaynight #swdinnerideas #slimmingworld #fakeaway
Chinese fakeaway Chicken balls Rice Salt and pepper fries Sweet and sour sauce Curry sauce Everything homemade other than the prawn crackers and I used frozen fries. Salt and pepper fries were cooked in the air fryer and I used @deanedwardschef recipe for them. He is my new fave account to watch and drool over having discovered him on tik tok. The curry sauce was a paste Joe picked up from the shop last night and it tasted exactly like Chinese curry sauce. The sweet and sour sauce came out quite dark but taste was there, God knows what they use in the sauce in takeaways, it was also a bit thick on the thick side but tasted great anyway and was no leftovers so everyone enjoyed. Little tip, I saved the little plastic tubs from when we had a takeaway last, there perfect for taking them on picnics for sauces. #fakeaway #chinesefakeaway #chickenballs #sweetandsour #chinesefood #rice #chinesecurrysauce #familyfood #familymeals #saturdaynightfakeaway #mealideas #dinner #dinnerideas #cardifffoodies #cdfblogs
Tandoori chicken tikka bowl by @kerislouisefitness β€οΈ This was AMAZING truly amazing π€© This is not a diet itβs a lifestyle . . #tandoorichickentikka #food #foodie #foodofinstagram #dinner #dinnerideas #caloriecounting #caloriedeficit #onplan #fitnessmotivation #fitnessandnutrition #saturdaynightfakeaway
Saturday night fakeaway- turkey kofta curry with added spinach; preferred rice rather than potatoes Spicy, filling & easy to do ππ #saturdaynightfakeaway #loveacurry #koftacurry #lovemyfood #dietwhatdiet #homecooking #healthyeating #easydinner #slimmingworldmember #slimmingworldrecipes #curryrecipe #slimmingworldlifestylechange #slimmingworldweightloss #slimmingworldfoodie #slimwithhannah #yesyoucanwithslimmingworld #slimmingworldworks #slimmingworldsuccess #fillyourplatelosetheweight #loseweightforgood #weightlossjourney
Fakeaway curries for dinner tonight π₯° Chicken Tikka Masala, Keema Matar , tarka Dahl, mushroom biryani and onion bhajis, popadoms and mango chutney Calories 925 Carbs 121g. Fat 18.7g. Protein 59.8g #fakeaways #fakeaway #curry #healthylifestyle #healthyfood #saturdaynightfakeaway #buildinghealthyhabits
π Chicken Gyros π Wow! I'm so impressed with what one of my members made as a totally on plan fakeaway - chicken gyros, with Slimming World chips, halloumi, salad, and homemade tzatziki and wholemeal wraps π Can I come round for tea please! π π₯° #yesyoucanwithslimmingworld #weightloss #slimmingworld #healthyeating #slimmingworlduk #dunston #lovefood #newcastle #healthyfood #gateshead #weightlosssupport #SlimWithGemmaP #healthylifestyle #loseweight #chickengyros #greekcuisine #fakeaway #Saturdaynight #saturdaynightfakeaway